KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102446386
Entry
102446386         CDS       T02980                                 

Gene name
ARNT
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator isoform X1
  KO
K09097  aryl hydrocarbon receptor nuclear translocator
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pss03000]
    102446386 (ARNT)
Transcription factors [BR:pss03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102446386 (ARNT)
SSDB
Motif
Pfam: PAS_3 PAS_11 PAS HLH PAS_9 PAS_4
Other DBs
NCBI-GeneID: 102446386
NCBI-ProteinID: XP_006132113
Ensembl: ENSPSIG00000008480
Position
Unknown
AA seq 776 aa
MASDVPSLGATAASGNPGPGTQSGVAIVQRTNKRRPGLDFDDDDDDEGTNKFLRCDDDQL
PNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPD
KLTILRMAVSHMKSLRGTGNTSADGTYKPSFLTDQELKHLILEAADGFLFIVSCETGRVV
YVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKE
GQQSMRMCMGSRRSFICRMRCGNSSVDPVSMNRLSFLRNRCRNGLGAVKDGEPHYVVVHC
TGYIKAWPPAGVSLPDDDPDAGQGSKFCLVAIGRLQVTSSPNCTDLNSICQPTEFISRHN
TEGIFTFVDHRCVATVGYQPQELLGKDVVDFCHPEDQQLLRDSFQQVVKLKGQVLSVMFR
FRSKNREWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQESRPAVSNSMQRSQQGQNV
GLPLEMGTPQLASRQQQTPQSELEVVPGRESLSGYDHSQVAVQPVTAAGPEHSKPREKAE
ALFSQERDPRFSEIYSSINTDQSKAIPASTVPANQPLFSQGNAFAPARPAESFRSSSMVP
PVNIIQQQPASAGQILAQISRHSNTTPVTATNWASATRPSFTAQQVASQTTKTRSPSFGM
GNFQGTPPSFSPMSTPGSTASPGVAAYPPLASRSTGFAAETGQTPAQFQTRTAEGVGMWP
QWPGQHHGQSSGEQHVQQQPSQPEVFPDMLSMLGDQGTNYNNEEFPELNMFPAFSE
NT seq 2331 nt   +upstreamnt  +downstreamnt
atggcctcggatgttccctctctgggtgcaacagctgcttctgggaaccctggacctggt
acgcagtctggagtagccattgtccagaggacaaacaagagacgaccagggcttgatttt
gatgatgatgatgatgatgaaggaaccaataaattcctcagatgtgatgatgatcagctc
ccaaatgataaagaaagatttgccaggtctgatgatgagcagagttcagcggataaggaa
agactggccagagagaatcacagcgagatagagcgcagacgtaggaacaagatgactgcc
tacatcacggagctgtccgacatggtgcccacctgcagtgccctggctcgcaagccagac
aagctgactatcttgcgcatggctgtctctcacatgaagtccttgcggggcaccggcaac
acctctgcagatggcacctacaaaccctcctttctcactgatcaggaactcaaacacttg
attctagaagcagccgatggctttctgttcattgtgtcttgtgagaccgggagggtggtg
tacgtctccgactcggtgactcccgtcctcaaccagccgcagtccgaatggtttggcagc
accctctatgaccaggtgcatcccgatgacgtggacaaattgcgggagcaactctctact
tcggagaatgctctgacaggtcgaatcctagatctaaagactgggacagtcaagaaggaa
ggccagcagtccatgagaatgtgcatgggctcaaggagatctttcatatgtcgcatgagg
tgcggcaacagctcagtagatccagtctccatgaataggctcagcttcttgaggaaccga
tgcaggaatggcttgggtgcagtgaaagacggggagccccattatgtggtggtccactgc
acgggatacatcaaagcctggccgcccgcaggtgtctcgttgccagacgatgacccagat
gctggccaggggagcaaattttgccttgtggccattgggaggttgcaggtcacgagctca
cccaactgcacagacctgaacagcatttgtcagccaacggagttcatctcccgacacaac
accgaaggcattttcacttttgtagatcaccgctgtgtggctacagttggctaccagcca
caggaactcctggggaaagatgttgtggatttctgtcatccagaggaccagcagcttttg
cgggacagctttcagcaggtggtgaagttaaaaggccaggttctgtcagtcatgttccga
ttccggtccaaaaaccgtgaatggctctggatgagaaccagctcctttaccttccagaac
ccctactcagatgagattgagtacatcatctgtaccaacaccaacgttaagaactcaagc
caggagtctcggcctgccgtgtctaactccatgcagcgctcacagcagggacagaacgtc
ggccttcccctggagatgggcacaccccagctggcatctaggcagcagcagacaccgcag
agtgagctggaagtggtcccaggaagagagagtctgtctggttatgaccattcgcaggtt
gctgttcagcccgtgactgctgctggcccagagcacagcaaaccacgggagaaagcggag
gctctgttcagtcaggagagggacccgcggttctcagaaatctactccagtatcaataca
gaccagagcaaagccattcctgccagcacagtgccagccaatcagcctctcttttcccag
ggaaacgcgtttgctcctgcacggcccgctgagagcttcaggagcagtagcatggtaccc
cccgtcaacatcatccagcagcagcctgcttcagctggccagattttagcccagatttct
cgccactccaacaccactcccgtcactgcaaccaactgggcatcagcaacacgaccgtcg
ttcacggcacagcaagtggcttcccagaccacaaagactcggtccccttcatttggaatg
gggaatttccaaggcacccctccctctttcagcccaatgtcaacgcctggttccacagct
tccccgggggtcgctgcttatccaccccttgccagccgcagcactggctttgccgctgaa
actggacagaccccagcccagttccagacacggacggcagaaggagttggcatgtggcct
cagtggccaggacaacaccacgggcagagctctggggagcagcacgtccagcagcagcca
agtcagcctgaggtcttcccagacatgctgtcaatgctgggagaccagggaaccaactac
aacaatgaagaattcccggagttaaatatgtttcctgccttttcagaataa

DBGET integrated database retrieval system