KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102446790
Entry
102446790         CDS       T02980                                 

Gene name
NPAS2
Definition
(RefSeq) neuronal PAS domain-containing protein 2
  KO
K09026  neuronal PAS domain-containing protein 2
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pss03000]
    102446790 (NPAS2)
Transcription factors [BR:pss03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102446790 (NPAS2)
SSDB
Motif
Pfam: PAS_11 PAS_3 PAS HLH PAS_9
Other DBs
NCBI-GeneID: 102446790
NCBI-ProteinID: XP_014434118
Position
Unknown
AA seq 784 aa
MDENEKDRAKRASRNKSEKKRRDQFNILIKELSSMLPGNSRKMDKTTVLEKVIGFLQKHN
EVSAQTDICEIHQDWKPSFLSNEEFTQLMLEALDGFVIAVTTDGSIIYASDSITPLLGHL
PCDVMDQNLLNFLPEQEHSEVYKILSSHTLLADSASPDYLKTDNDLEFYCHLLRGSLNLK
EFPTYEYIKFVGNFRSYSNVPTSTCNCFDGAVPRAYRTSLGKQVCFVATVRLATPQFLKE
MCIVEEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHIDDLELLARCH
EHLMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHTVVSYADVRVER
RQEMALEDAPSEIVSSALKDSDLSLDPEPHFNALEIGASVLNTNRTPSVSSRSSHKSSNT
PISDTASTPITESSGIRSLQRTTSIPQDSSMQRLSQTATLQASLPSQPSCELLPQQLLPQ
AALQNQPTSMAQFSAQFNMFQTIKEQLEQRTRMLQANIRWQQEELHKIQEQLCLVQDSSI
QMFLQQPTVSLSFSNVQQPDSQQLQQRSRVISQQQLIPSPQPQGQIASSQPANQQILREA
NVVSSQAVNMAPSAAVAQDSSQCHSSPDFSQDRQLRLLLSQPIQPMMPGSCNSRLASEIS
MAGCQAKYSQNQRLFQSLELQTSSSSSPIVLMGQAVLHPGFSASQTSQTSSLQPMQLQQH
QQHCYLQLQTPSSLHSELPDSLFLQSYSQQQGNIGYHHTQQQPLPLASRRTSSLSESSDL
PQPL
NT seq 2355 nt   +upstreamnt  +downstreamnt
atggatgaaaatgagaaagacagggcaaagagggcatcacgtaacaagtctgaaaagaag
agacgtgaccaattcaacattctcatcaaagagctcagctccatgcttccaggcaacagc
cgtaaaatggacaaaactacagtgcttgaaaaagtcattggctttctgcagaaacacaat
gaagtctcagcacagacagacatttgtgaaattcaccaagactggaagccttcgtttctc
agcaatgaagagttcacccagctgatgttggaggcattagatggcttcgttatagcagta
accacagatggaagtatcatatatgcttctgatagtattacacctctgcttggacattta
ccttgtgatgtcatggatcaaaatttgttaaatttcctcccagaacaagaacattcagaa
gtttataaaatattatcttctcatacgcttttggcagattctgcctcaccagattaccta
aagactgacaatgatttagagttttactgtcatcttctgagaggaagtttgaacctgaag
gaatttccaacatatgaatacataaaatttgtaggaaattttcggtcttacagcaatgtg
cctacttccacttgtaactgctttgatggtgctgtccctcgggcttatagaacatcacta
ggaaaacaagtctgttttgttgctactgttcgactggcaacacctcagtttttaaaggaa
atgtgtatcgtcgaagaacctttagaggaattcacttcaagacatagtctggaatggaaa
tttttatttctggaccacagagcaccgcctattataggatacttgcctttcgaagtattg
gggacttctggctatgattattaccacatcgatgacctagaactcttagcaagatgccat
gaacacttgatgcagtttggcaagggaaagtcttgttgttaccggtttctgaccaaagga
cagcaatggatctggctgcagacccattactatatcacctaccatcagtggaactccaag
ccagaatttattgtatgcacccacactgtagtaagttatgcagatgttcgagtggaaagg
agacaagaaatggccttggaagacgcaccttcagaaattgtttcttcagcactaaaggac
agtgatttaagcctggatcctgaaccgcactttaatgcgcttgaaataggtgcctcagtt
ctgaacactaatcggaccccctctgtatcatctagaagctcacacaaatcttccaacaca
cccatatctgacactgcatccacgccaatcacagagtccagtggaattcgctctttgcaa
agaacaaccagcatacctcaggattcatccatgcaaagactcagtcaaactgccactctt
caggcgtctttgccttctcagccatcatgtgagcttctcccacagcagctgctgccccaa
gcagctttgcaaaatcagcctacatctatggcacagttctcagcacaatttaacatgttc
cagaccatcaaggaacagttggagcagcgaactcggatgttgcaggccaacattcggtgg
cagcaggaagagctccataaaatacaggaacagctctgcttggtccaggattccagtata
cagatgtttttacagcagccaacagtgtccctgagctttagcaatgtacagcagccagat
tctcagcagctacagcagaggtcaagggtcatttctcagcagcagcttatccccagtcct
caacctcaagggcaaattgcatcttcccaaccagcaaaccagcaaatattaagagaagca
aatgtggtatcaagccaggctgtgaacatggctccatctgctgctgtagcacaggatagc
agccagtgtcattcaagtccagatttcagccaggaccgacaactgagactgttgctcagc
caacctattcagccaatgatgcctggttcctgtaattcaagacttgcttcagagatcagc
atggctggatgccaggctaaatattctcagaatcaacgactatttcaaagtctagaactg
caaacttccagcagcagttcaccaattgtgctgatgggacaagcagtactacatccagga
ttttctgcatcacagacttctcagacatcatctctgcagcctatgcaactccagcagcat
cagcagcattgctaccttcagttgcagacaccaagttctttacacagtgagctaccagat
tctttgttcctgcagtcctactctcaacagcaaggaaatataggataccatcatacgcaa
cagcagcctctgccacttgcttcaagaagaaccagtagcttgtcagaatcatcagatcta
ccacagccactatga

DBGET integrated database retrieval system