KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102448132
Entry
102448132         CDS       T02980                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pss01009]
    102448132 (AKAP5)
Protein phosphatases and associated proteins [BR:pss01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     102448132 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 102448132
NCBI-ProteinID: XP_006134141
Ensembl: ENSPSIG00000001038
UniProt: K7EZ25
Position
Unknown
AA seq 487 aa
MKKLEGRTTNMENTAKEIQMENRGPSEIHSSAKLCPSTEEQAEKLTMFCFKKRKKSCKKA
LVMKGDCEEDSVTLKHTSQSISAVPGEGETSNQAQLSGGAWATIKRLVTPRRRSKSSRKE
KHFDSQVHLEINAKDAGLQGFPKNRVGSGLKIPCIRFSRGKKKPSHSEITEESDCSVKAN
EITGILNKANNDPEDLAITIKSSVDQSVSQASEKSDRNSLNSTGENVLLVEPRPDGAQSE
ITNSEGVALLQENIHQKSIHETEQTVVVNKGIELNATLCTNVSEDLPDSTAEATDEQETN
KFHDKERELKESGKNTHASEDCKSREKKMSFNESAFKDDAVSTQGCLTEQLKLEENEDTN
IAGIVITVTEADEPEEEELNYDYNLPSISCEHKQKGNKKTSGNFSFSKLSNCKEGSVAGS
GPKREAKVCSPALPPRGPSDQEHGTSEQHELLLIETAASLVKAAIQSSIEQLVNEMALDH
SKQNSFL
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgaagaagttagaaggcaggaccacaaatatggagaatacagctaaagaaattcaaatg
gaaaacagagggccctcagaaattcatagttcagcaaaattgtgtccttcaactgaagaa
caggcagaaaaactcacaatgttttgctttaagaaaagaaagaaatcctgtaagaaggca
ttagtgatgaaaggtgactgtgaagaagactctgtaaccttgaaacatacaagccaatcc
atcagtgcagttcctggagaaggggaaacttccaatcaagctcagttgtcaggaggagct
tgggcaactataaaacgtctagtgacacctaggagaaggtctaaatcttcaaggaaggag
aagcattttgattctcaagtgcacctggagataaatgctaaggatgctggcttgcaaggt
tttccaaagaatcgggttggatcggggctcaaaattccctgcatacggttctcaagaggc
aagaaaaaacccagccattctgaaataacagaggaatcagactgcagcgttaaagcaaat
gaaataacgggcattttgaataaagctaacaacgatccagaggatttggcaataaccatc
aaatcaagcgtggatcagtctgtcagccaagcctctgaaaaaagtgataggaactcactt
aattccactggtgagaatgtacttttggtagagcccagaccagatggggctcaatcagaa
ataacaaattcagagggggttgctctactccaggaaaatatacatcagaagagcatacat
gaaactgagcagacagttgttgtgaacaaaggaattgagctcaatgccaccctctgtact
aatgtttctgaggacttaccagatagcacagctgaagccacagacgaacaagaaaccaat
aagttccatgacaaagaacgtgaattgaaagagtctggaaaaaacacacatgctagtgaa
gactgtaaatccagagagaagaaaatgagttttaatgagtcagcatttaaagatgatgct
gtcagcacgcagggctgtttaactgaacaattgaaattagaagaaaatgaggacactaat
atagcgggcattgtgattacagtgactgaagcagatgagcctgaggaagaggagttgaac
tatgactacaatctgccctcaatttcatgtgaacataagcaaaagggaaataaaaaaaca
agcgggaacttcagtttcagtaaactttctaattgcaaagagggctcagtagcaggcagt
ggcccaaagagagaggctaaagtctgttctcctgctctgccacccagaggtcctagtgac
caggagcacggaacttcagaacagcatgaactgcttctgatagaaactgctgcttcactc
gttaaggcggcgattcagtcatcgatagaacagctggttaatgaaatggctttggatcat
agtaaacagaacagttttctgtaa

DBGET integrated database retrieval system