KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102448866
Entry
102448866         CDS       T02980                                 

Gene name
PASD1
Definition
(RefSeq) circadian clock protein PASD1
  KO
K09026  neuronal PAS domain-containing protein 2
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pss03000]
    102448866 (PASD1)
Transcription factors [BR:pss03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102448866 (PASD1)
SSDB
Motif
Pfam: PAS_3 PAS_11 PAS HLH PAS_9 PAS_4
Other DBs
NCBI-GeneID: 102448866
NCBI-ProteinID: XP_025034631
Position
Unknown
AA seq 809 aa
MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELCTMLQGHGHPLKMDKSTILQRTIDFLQK
QKEITAQTEACEIRQDWKPSFLSNEEFTQLMLEALDGFLIALTTDGIIIYVSDSVSSLLG
HLPSDLVDQNILNFLPEREQSEVYKLLSPRVLMTDSVAADFLNTEKQIEFCCHLARGSLD
PNEPLTYEYVKFVVDFKYFTHVPTPSCNGFESAIARAFRSATEEQVCLVATVRLVTPQFL
KELCNVEEPCEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHADDLELLAR
CHEHLMQFGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHLVVSYAEVRA
ERRRDLGLEESSIELASSSLKSHNSYIDIRQCGANQDTGGDGVSRSSPSSRRSSHTALSD
SASTSSMRHTEGSTPTRPSAPGGQQEKASLRLASSGSAQALVTPQTPAEHHAPHHMAQPA
VPSQQAVMPVYHFPAQLGMMHQLKEQLEERTRILQADIKTQQEELHVIKEQLQLVQDSNL
QMLMQQPMPVVFNNVQPHSPRRPSQAQQPGATRQTTAKKSQPQGLMGSKHYSAPHLPSPH
QFLREPSVTSSQVQQQQQQQALRGSQACLPVQTSISMPLYNSPMVFSQTHALAGAAPLPA
EMGERQPPSDYSPDRSLRMLLDQPVQTLMSSATGSNQSSQNSAGHQQANFVPEQQMLPPP
LQMQPITCSTVRVPAPSPVFTPSVMIPQANFTSHQTQPPVHLHQWPPQQQGQQHLGGVWK
CHSEIRTGVGNKPAGHGSPGLAPGRLPHT
NT seq 2430 nt   +upstreamnt  +downstreamnt
atggatgaagatgagaaggacagggcaaagagggcatcacgcaacaaatctgaaaagaaa
aggcgagaccagttcaatgtcctcatcaaagagctctgcacaatgctgcagggtcatggc
caccctctcaagatggacaagtccacaatattgcagcggaccattgacttcttgcagaaa
cagaaagaaatcacagcacagaccgaggcctgtgagattaggcaagactggaagccttcg
tttcttagcaatgaggagttcacccagttgatgttagaggcattagatggatttctcatt
gcacttaccactgacgggattattatttatgtatctgatagcgtctcctctcttctcgga
catttaccgtcagatttggtggaccaaaatatattgaactttctgcctgagcgggagcag
agcgaggtgtacaagcttctttctccacgggtgctcatgacagactcggttgcggctgat
tttctaaacactgaaaagcaaatagagttttgctgccatttagcaagaggaagcttagat
ccaaatgagcccctaacatatgaatatgtgaaatttgtagtggattttaaatattttact
catgtgcctacaccctcctgcaatggctttgaatcagctatcgccagagcattcaggtca
gccactgaagagcaggtttgcctcgtagcaaccgttcgtctcgtgacgccgcagttttta
aaggagctgtgcaacgtggaggagccatgtgaagaattcacctccagacacagtttggag
tggaagtttttattcttggaccacagggccccgcccatcataggctatttaccctttgag
gttctgggaacgtcaggttacgattattaccacgctgatgacctggagcttcttgctagg
tgccatgaacacttgatgcagtttggaaaaggcaagtcctgttactacagattcttgacc
aaaggccagcaatggatatggctgcagacacactactacatcacgtaccatcaatggaat
tccaaaccggagttcattgtttgcacgcacctggtcgtgagttatgcagaggttcgagcg
gaaaggaggagagatcttggccttgaggagtcatcaattgaactggcatcttcttctttg
aagagtcacaacagttacatagacatccggcaatgcggcgccaaccaagacaccggcggg
gacggggtgtccagatcctccccgagctcccggcgctcgtcgcacacggccctctccgac
tcggcctccacctcctccatgcggcacacggagggcagcactcccaccaggccatccgcg
cccgggggccagcaggagaaggcgtcgctgaggctggcctcaagtgggagcgcacaggcc
ctcgtaactcctcagacacctgccgagcatcatgcgccgcatcacatggcccagccggcc
gtcccctcgcagcaagcagtgatgccagtgtaccacttcccagcccagttagggatgatg
catcagcttaaagaacagctggaggagaggacgcgtatattgcaagccgacatcaagacg
cagcaagaagagctccatgtgatcaaagagcagctccaactagtgcaagattccaacctg
cagatgttgatgcaacagcctatgcccgtagtctttaacaacgtacagccgcacagccca
aggcggccgtctcaagcgcagcagcccggggcgaccaggcagacgaccgccaagaaatct
cagccacagggccttatgggatccaaacactacagtgccccccacttaccatcaccacat
caattcctcagggaaccgtcggtcacgtcctcccaggtgcagcagcagcagcagcagcaa
gccctgcgaggcagccaagcgtgtctgccggtgcagaccagcatttcaatgcccctctac
aacagccccatggtgttctcccaaacgcacgccctcgctggggccgccccgctgcccgcc
gaaatgggcgaaaggcagccaccgtctgactacagcccggataggagtttacgaatgttg
ttggatcagcccgtgcagaccctgatgtccagtgcgactggcagtaaccagtcatcacaa
aacagtgctggccaccagcaagcaaactttgttccagaacagcagatgctgcctcctcct
ttgcagatgcagccgattacatgtagcacagtcagggttccggctccttctcccgtattc
accccttcggtgatgattccacaggccaacttcacttcccaccagacgcagcctcccgtt
catctccatcaatggccacctcaacagcagggtcagcaacatctgggcggggtttggaag
tgtcactcagagatcagaacaggggtgggcaataagccagccggacacggttcaccaggt
ttagcgcctggcaggttgccacatacttga

DBGET integrated database retrieval system