KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102449218
Entry
102449218         CDS       T02980                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pss03036]
    102449218 (ANKRD53)
Chromosome and associated proteins [BR:pss03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    102449218 (ANKRD53)
SSDB
Motif
Pfam: Ank_4 Ank_5 Ank_3 Ank_2 Ank
Other DBs
NCBI-GeneID: 102449218
NCBI-ProteinID: XP_025042341
Position
Unknown
AA seq 328 aa
TPNAPSQKGFSAIHLAALHGRLECLKLIIENFEVDVNLPSLTGWSPIHLVMNKESGPNAL
ECLQYLIEKGADINVQNQGGMSPLHKAASEGRLDCIIELVEAGADVHAKDLEGQEPFDLC
KIRAHRSCARYLRNAMWKIEKRNFACEMHKLNQLKSHCQRTEQHFLKVEKKEQEILNALA
FSNWLRTKKQQQPKKMPLPEDRLIIAAVPKEKVGKTPSGGKKVQVYAKRRATVRETPQPS
RGKSQRAWNTSVNPSSPVVTDIFRPTTVRLGTDPEVCGDHDFSSFLFLSKDARGKPVIEM
AYAGALRCDRAELVPRCAAPPHKAAAGF
NT seq 987 nt   +upstreamnt  +downstreamnt
acccccaacgcgccgtcacagaagggcttctcagccatccatttagcagctctacatggc
cggctggagtgcctgaaactgatcatcgaaaactttgaggtggacgtgaacttgcccagt
ctgacgggatggtcacccatccatctggtgatgaacaaggagagcggccccaacgcattg
gagtgtttgcagtacctcatcgaaaaaggagccgacatcaatgtgcagaaccagggagga
atgtccccacttcacaaggctgccagcgaagggcgcctggactgcatcattgagctggtg
gaagctggagctgatgtccatgccaaagatctagaggggcaggaaccctttgacctgtgc
aagataagggcccacagaagctgtgctagatatctgcgtaacgccatgtggaaaatagag
aagcgcaattttgcttgtgaaatgcacaagctgaaccaactcaaaagtcactgtcagcgc
accgaacagcacttcttgaaggtagagaagaaggagcaggaaatcctaaatgcactggca
ttttctaactggcttagaacgaagaagcagcagcagcctaaaaagatgcctttaccggag
gacagactgatcatagctgccgtccccaaggagaaagtgggcaaaacaccgtctggaggg
aaaaaagtccaggtgtatgccaagcgcagggctacagttagagagacaccacagccttcc
agagggaagtcccagcgagcttggaataccagcgtcaacccctcttccccggtggtgaca
gacatcttccgacctacaaccgtccggctgggcactgaccccgaggtctgcggggatcac
gacttcagctccttcttgtttctctccaaggacgcccgtgggaagccggtgatcgaaatg
gcttacgccggcgccctacgatgtgatcgagcggagcttgtaccccggtgcgcggcccct
ccgcataaagctgccgcaggattttaa

DBGET integrated database retrieval system