KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102449242Help
Entry
102449242         CDS       T02980                                 

Gene name
ALDH5A1
Definition
(RefSeq) succinate-semialdehyde dehydrogenase, mitochondrial
  KO
K00139  succinate-semialdehyde dehydrogenase [EC:1.2.1.24]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00250  Alanine, aspartate and glutamate metabolism
pss00650  Butanoate metabolism
pss01100  Metabolic pathways
Module
pss_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    102449242 (ALDH5A1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102449242 (ALDH5A1)
Enzymes [BR:pss01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     102449242 (ALDH5A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF2684
Motif
Other DBs
NCBI-GeneID: 102449242
NCBI-ProteinID: XP_006134056
Ensembl: ENSPSIG00000004895
UniProt: K7FB40
Position
Unknown
AA seq 448 aa AA seqDB search
MRSMTLIQYGNILIYVQNKGSFAKIPFFFVQERSVLLRKWYNLMMDNKDDLAKIITAENG
KPLKEAQGEILYSAAFLEWFAEEARRIYGDIIPPSVKDRRILVLKQPVGVAAIITPWNFP
SAMITRKVGAALAAGCTVVVKPAEDTPLSALALAELANQAGIPPGVYNVVPCSRQQTPAV
GEALCTDPLVAKISFTGSTATGKVLLHHAAGTVKRVSMELGGHAPFIVFDSADVDRAVAG
ALASKYRNSGQTCVCTNRFLVQKRIHDAFVEKFAKAIERELRVGNGFDEGTTQGPLINEK
AIKKVERHISDAVSQGASIMTGGKRHSFGKNFFEPTLLSNVTTKMLCTQEETFGPLAPVI
KFDTEAEAVAIANSASVGLAGYFYSRDTAQIWRVAEQLEVGMVGVNEGIISSVECPFGGV
KESGLGREGSKYGVDEYLEIKYVCFGGL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtatgacgttaattcagtatggtaacattcttatctatgttcaaaacaagggt
agctttgctaaaataccttttttctttgtccaggagagaagtgtgttacttcgcaaatgg
tacaatttgatgatggataataaagatgaccttgctaagataattacagcagagaatgga
aagcccttgaaagaggcgcaaggtgaaattctgtattctgccgccttcctggaatggttt
gcagaagaagctcgtcgcatttatggggacattatcccaccttctgtgaaagatagaaga
atcttggtactgaagcagcctgttggagtggcagccattataaccccttggaatttccct
agtgctatgattacacggaaggttggtgcagctctggcagcaggctgtactgtggtggtg
aagcctgcagaagacacaccattatcagcgttggcacttgctgagcttgcaaaccaggct
ggaattccaccaggcgtatataatgttgtcccctgttcccgacaacaaaccccagctgtg
ggagaggctctctgcactgatcccttagtagcaaaaatttcttttactggctccactgct
acaggaaaggtattgctgcaccatgctgcagggactgtgaagcgggtttccatggagctt
ggagggcatgctccatttatagtgtttgatagtgctgatgtggaccgagcagttgcagga
gcattagcttctaaatacagaaactcagggcagacatgtgtttgcacaaaccgatttttg
gtgcaaaaaaggatccatgatgcatttgtggaaaaatttgctaaagccattgagagagag
ttacgtgtaggaaatggatttgatgaaggaactactcaagggccattaattaatgaaaaa
gcaataaaaaaggtagagagacacattagcgatgcagtttctcaaggagcatctatcatg
acaggagggaaacgacacagctttggaaagaatttctttgagcctactctgctcagcaat
gtcacaacaaaaatgctttgcacgcaagaagagacatttggtccgttagcaccagttatc
aagtttgatactgaagcagaagctgttgctatagcaaattcagccagcgtgggtttagca
ggatatttctattctcgagacacagcgcagatctggagagttgcagagcagctggaggtt
ggaatggttggtgttaatgaagggattatatcctctgtggagtgcccttttggtggcgta
aaagagtctggcttaggacgagaaggttcaaaatatggtgttgatgagtacctagaaata
aagtatgtctgctttgggggcttataa

DBGET integrated database retrieval system