KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102449429Help
Entry
102449429         CDS       T02980                                 

Gene name
HNMT
Definition
(RefSeq) histamine N-methyltransferase isoform X1
  KO
K00546  histamine N-methyltransferase [EC:2.1.1.8]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00340  Histidine metabolism
pss01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    102449429 (HNMT)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pss04147]
    102449429 (HNMT)
Enzymes [BR:pss01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.8  histamine N-methyltransferase
     102449429 (HNMT)
Exosome [BR:pss04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102449429 (HNMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_12 Methyltransf_31
Motif
Other DBs
NCBI-GeneID: 102449429
NCBI-ProteinID: XP_006117105
Ensembl: ENSPSIG00000007919
UniProt: K7FKX6
Position
Unknown
AA seq 292 aa AA seqDB search
MASSMRSLLSDHSRYVESFRLFLENSTEHQCMLEFIDRKLPGIISSIGKGKSAINILSVG
GGSGEIDLQILSKVQAKYPGVAINNEVIEPSNEQILSYKERVAKTSKLENIKFTWHKETS
SEYESRIKEKKEFKKWEFIHMIQMLYYVKDIPATIQYFHSLLEAKAKLLIILVSGTSGWA
QLWKKYGPRLPLNDLCLYVSSADIKEQLDIIGLKYQIYELPSTMDITSCFIAGNKEGELL
LDFLTETCYFSKTAPLDLKNEIMEELKKPECSEERGGKVFFNNSLSAIVIEP
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcatcttctatgaggagcttgctctccgaccacagccgatatgtggaatcttttcgt
ctgttccttgagaactcgacggagcaccaatgtatgctggaattcattgacaggaagctg
ccgggcataatatcgagcatcggaaaaggaaaatctgcgatcaatattctaagtgtaggt
ggaggttcaggtgaaattgaccttcagattctctcaaaagtacaggccaaatatccagga
gttgccattaacaatgaggtgatagaaccaagcaatgaacaaatcctcagctacaaagaa
cgtgtcgctaagacttcaaagcttgagaacataaagtttacctggcataaggagacgtcg
tctgaatatgaaagtcgaatcaaggagaaaaaagagtttaagaaatgggaattcattcac
atgatacagatgctctactatgtaaaagatatccctgcgactattcaatactttcacagt
ctcctggaagctaaagctaagctgctcattattctcgtctcaggaaccagcggctgggca
cagctgtggaagaaatatggacctcgcttacctctaaatgatctttgcttatatgtttca
tctgctgacatcaaagagcaacttgatataatagggctgaagtatcagatctatgaactt
ccatccactatggacataaccagttgttttattgcaggaaacaaagagggggagctgctg
ttggattttttgacagaaacctgctattttagtaaaactgctcctcttgatctgaaaaat
gaaataatggaagaactcaaaaaacctgaatgcagcgaagaaagaggtggaaaggttttc
tttaataacagcttgagtgcaatagtgatagaaccatga

DBGET integrated database retrieval system