KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102449444Help
Entry
102449444         CDS       T02980                                 

Gene name
QRSL1
Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00970  Aminoacyl-tRNA biosynthesis
pss01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pss00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    102449444 (QRSL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pss03029]
    102449444 (QRSL1)
Enzymes [BR:pss01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     102449444 (QRSL1)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     102449444 (QRSL1)
Mitochondrial biogenesis [BR:pss03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    102449444 (QRSL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 102449444
NCBI-ProteinID: XP_006123303
Ensembl: ENSPSIG00000018066
Position
Unknown
AA seq 521 aa AA seqDB search
MELGWISAALKEGQVSPTELCQRCLSLIKATKFLNAYITVAEETALKQAEESEERYKRGQ
ILGDLDGVPVAIKDNFSTAGIETTCASNMLKGYIPPYNATVVQKLLDQGAVLLGKTNLDE
FAMGSGSTDGIFGPVRNPWSYSRQYREKCVQNTQTENEDSNWLITGGSSGGSAAAVSSFT
CFTALGSDTGGSTRNPAALCGVVGLKPTYGLISRHGLIPLVNSMDVPGILTRCVDDAAIV
LGVLAGHDPKDSTTVQDPFKPFELPSFIDASKLCIGIPKEYHAPGLSSETLALWSKAADL
FENAGARVKEVSLPHTQYSIICYHVLCTAEVASNMARFDGLEYGHRSSMDKSTEVMYAAT
RREGFNDVVRGRILSGNYFLLKQNYENYFIKAQKVRRLIANDFVNVFNGGIDVLLTPTTL
RDTIPYVEFIKEDNRTRSAQDDIFTQAANMAGLPAITVPTAVSERGLPIGLQFIGRAFRE
QQLLTVAKWFEKQVQFPMIQLQGMMDHGHIVSLHQKSASLS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggagctaggatggatctctgcagcactgaaagaaggccaagtgagtccaacagagctt
tgtcaaagatgtctctcccttatcaaagccaccaaatttcttaatgcttacattactgta
gccgaagagacagcattaaaacaagctgaagaatcagaagagagatataagagaggtcag
atactgggggatttagatggagttcctgtagcaataaaagacaacttcagcacagctgga
attgaaacaacatgtgcatcaaacatgctgaaaggttatattcccccttacaacgctaca
gtagttcagaagttattggatcagggggctgtgcttctaggaaaaacaaatctagatgaa
tttgcaatgggatctgggagcacagatggaatatttggaccagtcagaaacccctggagt
tattcaaggcagtatagagaaaaatgtgtgcagaacacccagactgagaatgaagactcc
aattggctgataacaggaggaagctcaggaggcagtgctgctgcagtgtcttctttcaca
tgttttacggctttaggatcagatacaggagggtccaccagaaacccagctgctctctgt
ggagtagtaggtttaaaaccaacctatggactgatttctcgtcatggtctcattccatta
gtgaactccatggacgtaccaggaattttaaccagatgtgtggatgatgcagcgattgta
ttaggtgtgcttgcaggtcatgatcccaaagactctactactgtgcaggatccctttaag
ccgtttgaactaccgagttttatagatgccagcaagctctgtataggaataccaaaggaa
taccatgcaccaggattatcaagtgaaactctggcactttggtctaaggctgctgatctc
tttgagaatgcaggtgccagagtaaaggaagtgagtctaccccacacacagtattcaatt
atctgctatcatgtgctgtgcacagcagaagtagcatcaaatatggctaggtttgatgga
ctagaatatggacaccgttctagtatggacaagtccacagaagtcatgtatgctgcaaca
cgacgagaagggtttaatgatgttgtcagaggaagaattctatcaggaaactactttttg
ttaaaacagaactatgaaaattattttatcaaggcccaaaaagttagacgactcatcgcc
aatgactttgtgaatgttttcaatggtggtattgatgttttgctcactcctactactcta
agagatacaataccatatgtagaatttatcaaagaagacaatagaacccgcagtgcacag
gatgatatttttacacaggccgcaaacatggcagggctgccagccataactgttccaaca
gcagtttcggagagaggtttgccaattgggcttcagtttattggccgtgcattccgagag
cagcagcttcttactgtagccaaatggtttgaaaaacaagtacagttccctatgatacaa
ttacagggaatgatggatcatggtcacattgtgtctctccatcagaaatccgcctctctt
tcataa

DBGET integrated database retrieval system