KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102450065Help
Entry
102450065         CDS       T02980                                 

Gene name
ABHD12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pss01002]
    102450065 (ABHD12)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pss04147]
    102450065 (ABHD12)
Enzymes [BR:pss01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102450065 (ABHD12)
Peptidases [BR:pss01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   102450065 (ABHD12)
Exosome [BR:pss04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   102450065 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Thioesterase Peptidase_S15 Peptidase_S9 Say1_Mug180 Abhydrolase_2
Motif
Other DBs
NCBI-GeneID: 102450065
NCBI-ProteinID: XP_014435967
Ensembl: ENSPSIG00000003644
UniProt: K7F735
Position
Un
AA seq 324 aa AA seqDB search
MLIWLLAVYIAIPFLVKLCPSIQVKLVFLNFVRVPYFIDLKRPQDQGLNHTYNYYLQPEE
DVTIGVWHTVPTALWKDAQGKGHPWYEDALGSNYPVILYLHGNAGTRGGDHRVELYKVLS
FLGYHVVTFDYRGWGDSVGTPSERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATN
LVRRLCERETPPDALILESPFTNIREEARSHPFSVIYRYFPGFDWFFLDTITMSGIKFAN
DENVKYISCSLLILHAEDDPVVPFHLGKKLYNIAAPSRSFRDYKVQFVPFHRDLGYRHKY
IYRSPELPRILREFLGKPQHAQRH
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgttaatctggttgttggcagtatacatagccattccatttctagtaaaactttgtcct
tctattcaggtgaagctggtcttcttaaattttgtgagggttccgtatttcattgacttg
aaaaggccacaggatcaaggcttaaaccacacctataattattaccttcagccagaggag
gatgtaaccattggagtctggcacacagttcccacagccttgtggaaagatgctcaaggc
aaaggccatccgtggtatgaggacgctctgggatccaattatcctgtaatcctttatttg
catggaaatgcaggaactaggggaggggatcaccgtgtggagctttacaaggtcctgagt
ttcctcggttaccatgtcgtcacgtttgattatcgagggtggggcgactcggtgggcacg
ccgtcggagagaggaatgacctacgacgcgctccatgtgtttgactggataaaagcaaga
agcggagacaaccctgtctacatatgggggcactccttaggcacaggagtcgcaacaaat
ttagtgaggcgcctttgtgagcgagaaactcctccggacgccctgatcctggaatccccc
tttactaacatacgcgaagaagcaaggagccatccgttttcagtgatatatagatacttc
cctgggttcgactggttcttcctcgacaccatcacaatgagtggaattaaattcgccaat
gatgagaacgtgaaatacatttcctgctcgttgcttattcttcatgctgaagatgaccct
gttgtaccatttcatctcggaaagaagctgtataacatagctgcaccatctcggagtttc
cgtgactacaaagtacagtttgttccgtttcacagagacctaggctacaggcataagtac
atctacaggagtccagagctacctcggatcctgcgggagttcctgggcaaaccccaacat
gcccagcgccactga

DBGET integrated database retrieval system