KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102450840Help
Entry
102450840         CDS       T02980                                 

Gene name
HTR4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4 isoform X2
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04020  Calcium signaling pathway
pss04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102450840 (HTR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102450840 (HTR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pss04030]
    102450840 (HTR4)
G protein-coupled receptors [BR:pss04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    102450840 (HTR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 102450840
NCBI-ProteinID: XP_006138160
Ensembl: ENSPSIG00000006016
Position
Unknown
AA seq 387 aa AA seqDB search
MEELDVNVSSTEGFGVAEKIALLTFISAVILMAILGNLLVMVAVCRDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDKWIYGEMFCLVRTSLDVLLTTASILHLCCISLDRYY
AICCQPLVYRNKMTPLRISLMLGGCWTIPTFISFLPIMQGWNSIGILDLIQQRQFNKTSN
STYCIFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYITAREHAHQIQILQRAGAPTEGRQ
HHPDQHSSHRMKTETKAAKTLCIIMGCFCLCWAPFFITNVVDPFINYTVPGQLWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCGDERYRRPSILGQTVPCSTTTINGSTHVLRY
TVLHNGHHQEHDKLPIHNDPESQESCF
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggaagaacttgatgttaatgtgagttcgactgaggggtttggtgtggcagagaagatt
gccctgctcaccttcatatcggcggttatactcatggccatcctggggaacttgctggtg
atggtagctgtatgcagagacaggcagctcaggaaaatcaagaccaattatttcattgtc
tcacttgcctttgcggacctgctggtgtctgtgctggtgatgccctttggagccattgag
ctggttcaggataaatggatttatggagagatgttctgcctggtccgaacatctctagat
gtcctgctcaccacagcatcaatccttcacctgtgctgtatctccctagacaggtactat
gctatctgctgccaacctctggtttacaggaataagatgacaccgttgcgcatttctcta
atgcttggagggtgctggaccatcccaacctttatttcctttctccctataatgcaaggc
tggaatagcattggcatattagacttgatacaacaaagacagttcaacaaaacttccaac
tcaacctactgcatattcatggtcaacaagccctatgccattacttgctcagtggtggcc
ttctacattccatttttattaatggtgctggcctactatcggatttacatcacagccagg
gagcatgcccaccagatccagatcctccagcgtgcaggagcacccacagagggaaggcag
caccacccagatcagcatagctctcaccgtatgaagactgagaccaaagctgccaagacc
ctgtgcatcatcatgggttgcttctgcctgtgctgggccccgttctttatcactaatgtc
gtggacccattcataaactacactgtacctgggcagctgtggacagctttcctgtggttg
ggctacatcaattcagggttgaaccccttcctgtatgccttcctgaacaagtctttcagg
cgtgccttcctcatcattctttgctgtggggatgaacgataccgaaggccttccatcctg
gggcaaactgtcccctgctccaccaccactataaatggatcaacacacgtgctaaggtac
acagttttacataatggacatcaccaggaacatgacaagcttcccatccacaatgaccca
gaatcccaggagtcctgtttctaa

DBGET integrated database retrieval system