KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102451515
Entry
102451515         CDS       T02980                                 

Definition
(RefSeq) adenylate cyclase type 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00230  Purine metabolism
pss01100  Metabolic pathways
pss04020  Calcium signaling pathway
pss04114  Oocyte meiosis
pss04261  Adrenergic signaling in cardiomyocytes
pss04270  Vascular smooth muscle contraction
pss04371  Apelin signaling pathway
pss04540  Gap junction
pss04912  GnRH signaling pathway
pss04914  Progesterone-mediated oocyte maturation
pss04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102451515
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102451515
   04020 Calcium signaling pathway
    102451515
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102451515
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102451515
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102451515
   04914 Progesterone-mediated oocyte maturation
    102451515
   04916 Melanogenesis
    102451515
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102451515
   04270 Vascular smooth muscle contraction
    102451515
Enzymes [BR:pss01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102451515
SSDB
Motif
Pfam: Guanylate_cyc AC_N
Other DBs
NCBI-GeneID: 102451515
NCBI-ProteinID: XP_014430786
Position
Unknown
AA seq 627 aa
MNPCATPTLAGVFPEFASNLGFLLTLLVALAVFSLILLLVCIESVFQRCTRLFSALIWAC
LLAMAYVSVFTSGVVNAWDQVRGGGEGTLLANAVIFICGNLVGAYHKHLMEVALQETFQE
TFKLIHSRVKLESEKRHQDNECMRIKILGDCYYCVSGLPVSLPNHACNCVKMGLDMCQAI
KKLRDATGVDISMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRGGTGC
AAVCTQPWLRVSLGIATILLVLTMAVLNLYYIYCSILGLVSCSLFLHMNFELKLLLLTLC
LVVYNVLFLHSRAWLSDCYVGRLYPNQTLLRPGVLKEPKLMGAVSLFVFFFTLLALARQN
EYYCRLDFLWKKKFKKEREEIETMENLNRVLLENVLPADVAQQFIGQNRRNEDLYHQSYG
CVCVLFASIPDFKEFYSESNVNHEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIGST
YMAATGLNATSGQDNEQDGERSYTHLGIMVEFAVALIGKLDIINKHSFNSFKLRVGINHG
PVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETAKALKTLGYTCYLRGVIK
VKGKGQLRTYYVSTDLSRSSLQASMLS
NT seq 1884 nt   +upstreamnt  +downstreamnt
atgaacccctgtgccacccccaccctggcgggcgtgttccctgaattcgcctccaacttg
ggcttcctgctcaccttgctggtggccttggccgtcttctccctcatcctcctgctggtc
tgcatcgagagcgtcttccagcgctgcacccggctcttctcggccctcatctgggcctgc
ctcctggccatggcctacgtctccgtcttcaccagcggggtggtcaacgcctgggaccag
gtgagagggggaggtgaggggacgctcctggccaatgcggtgatcttcatctgtggcaac
ctagtgggcgcctaccacaagcacctgatggaggtggccttgcaggagaccttccaggag
accttcaaactcatccactcccgggtcaagctggagtctgagaagcggcaccaggacaac
gagtgcatgaggatcaagatcctgggcgattgttactactgcgtctcggggttacccgtg
tccctgcccaaccacgcctgcaactgcgtcaagatgggcttggacatgtgccaggccatc
aagaagctgcgggacgccaccggggtggacatcagcatgcgggtcggggtgcactcgggg
aacgtgctgtgcggggtcatcggcctgcagaagtggcagtacgacgtctggtcccacgac
gtgacgctggccaaccacatggaggccggaggggtgcccgggcgtggcggcaccgggtgt
gcggccgtctgcacccagccctggctccgcgtcagcctgggtatcgccaccatcctactg
gtcctcaccatggccgtgctcaacctctactacatttactgcagcatcctggggctggtc
tcctgctccctgttcctgcacatgaactttgagctcaagctgctgctgctgacgctgtgc
ctggtggtctacaacgtcctcttcctgcacagccgcgcctggctctccgactgctacgtg
gggcgcctctaccccaaccagaccctgctcagaccaggggtcctgaaggagcccaagctg
atgggagccgtttctctcttcgtcttcttcttcaccctgctggccttggctagacaaaac
gagtactattgccgcctggacttcctgtggaagaagaagttcaagaaggagcgggaggag
atcgagaccatggagaacctcaaccgggtcctgctggagaacgtgctcccggccgacgtg
gcgcaacagttcatcggccagaaccggcggaacgaggacctttaccaccaatcctacggc
tgtgtctgcgttctctttgcctccatccctgacttcaaggagttctactccgagtccaac
gtcaaccacgaagggctggagtgtctgcggctgctcaacgagatcattgcggattttgat
gagctgctctcaaagccaaaattcagtggtgtggagaagatcaagaccattggcagcacc
tacatggccgctacgggattaaatgccacctctggccaggacaatgagcaggatggcgag
aggagctacacccatctaggcatcatggtggagtttgctgtggccctgataggcaagctg
gacattatcaacaaacactccttcaacagcttcaaactccgtgtgggtataaaccatggc
ccagtggtggcgggtgtgatcggagcccagaaaccccagtatgatatttgggggaacacg
gtcaacgtggccagtcgcatggagagcaccggggtgcttgggaagatccaggtcacagaa
gagacggccaaagccctgaagaccctgggttacacctgctacctccgtggagtcatcaaa
gtcaagggaaaaggccaactacggacctactacgtcagcacggacttatcccgctccagc
ttacaggcttccatgctcagctga

DBGET integrated database retrieval system