KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102452664
Entry
102452664         CDS       T02980                                 

Gene name
RDH5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102452664 (RDH5)
Enzymes [BR:pss01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     102452664 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2
Other DBs
NCBI-GeneID: 102452664
NCBI-ProteinID: XP_014433038
Ensembl: ENSPSIG00000002991
UniProt: K7F4Z9
Position
Unknown
AA seq 251 aa
MWVYMGLVALVWALGWYLRDRQTLASVHDKHVFITGCDSGFGHLLARRLDRKGFRVLAGC
LTQKGADNLQRASSASPRATLLIEVTLAFLPLLKRARGRVVNTSSVLGRLSANGGGYCVS
KYTVEAFSDSLRRDMYHFGVRVSIVEPGFFKTAVTSLDTIEASLQQLWDQMTPEARQSYG
EDFFKQYLKVQRLIMNFICDPDLSKVTNCMEHALQAKHPRTRYSAGWDAKLLWLVDFVLA
TILPKPAHRVR
NT seq 756 nt   +upstreamnt  +downstreamnt
atgtgggtctacatgggcctggtggccctagtgtgggcgctaggctggtacctgcgggac
cgccagaccctggccagcgtccatgacaagcacgtcttcatcacgggctgcgactcgggc
ttcgggcacctgctggcccggcggctggaccggaagggtttccgcgtgctggctggctgc
ctgacccagaagggggccgacaacctgcagcgcgccagctccgccagcccgcgcgccacc
ctcctcatcgaggtcaccctggccttcctgccgctgctgaagcgggcgcggggccgcgtg
gtcaacacgtccagcgtgctggggcggctctcggccaacgggggcggctactgcgtctcc
aagtacaccgtggaggccttctccgacagcctgcggcgggacatgtaccacttcggcgtg
cgggtctccatcgtggaacccgggttcttcaaaacggccgtgaccagcctggacaccatc
gaggcatcgttgcagcagctgtgggaccagatgacaccggaggcccggcagagctacggg
gaggacttcttcaagcagtacctgaaggtgcagcggctcatcatgaacttcatctgcgac
cccgacctgagcaaggtcaccaactgcatggagcacgcactgcaggccaagcacccgcgc
acccgctacagcgccggctgggacgccaagctgctctggctggtggacttcgtgctggcc
acgatcctgccgaagccggcccaccgcgtgcgctag

DBGET integrated database retrieval system