KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102452728Help
Entry
102452728         CDS       T02980                                 

Gene name
TTN
Definition
(RefSeq) LOW QUALITY PROTEIN: titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pss01001]
    102452728 (TTN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pss04131]
    102452728 (TTN)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pss04812]
    102452728 (TTN)
   04147 Exosome [BR:pss04147]
    102452728 (TTN)
Enzymes [BR:pss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102452728 (TTN)
Protein kinases [BR:pss01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   102452728 (TTN)
Membrane trafficking [BR:pss04131]
 Others
  Actin-binding proteins
   Others
    102452728 (TTN)
Cytoskeleton proteins [BR:pss04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     102452728 (TTN)
Exosome [BR:pss04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102452728 (TTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 Ig_2 ig V-set Pur_ac_phosph_N C2-set_2 fn3_2 Ig_6 C1-set PPAK Receptor_2B4 Pkinase Ig_5 Titin_Z Tissue_fac fn3_4 Pkinase_Tyr Ig_4 THB Adeno_E3_CR1
Motif
Other DBs
NCBI-GeneID: 102452728
NCBI-ProteinID: XP_025038559
Ensembl: ENSPSIG00000011160
Position
Unknown
AA seq 37808 aa AA seqDB search
MTTKAPTFTQPLKSVVALEGSAATFEAHISGSPVPEVSWFRDGQVISAATLPGVQISFSD
GRAKLMIPAVTAANSGRYSLQATNRSGQASSTVELLVTAETAPPNFTQRLQSITVRQGKQ
VRLDVKVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLIIAEAYPEDSGTYSVNATN
SVGRATSTAELLVQGEEEAVPAKKTKTIVSTAQISQTRQARIEKKIETHFDARSLTTVEM
SIDSTTGQQLPHKAPPRMPPRPTSKSPTPPISAAKVQMARQQSPSPIRQSPSPVRHVRAP
TPSPVRSVSPAGRFSTSPIRPVKSPLLTRKAQATVATAADVLPPWKQESFVSASEARMQE
TRVTTSATQIRTEERWEGRYGVQDQVTISGAAAGVAVAGVAAGAKEDIDKTAAVATVLAA
VDLARVREPVPSPVEQVAKRTAMTAVHIQPGQEQIRKQAMIVVATDKSKEQEIISRTREG
IATKQEVHITREKIRKEPEKTPIPKVIIAVDKTKEQEKISRAREEISTKGEQIHITHEKI
RKEAVKPSVPKVVITTEKPKEQVIISRTREEIATKQERVQVTDEKIRKEAEKTTIIPAVI
ATDKFKEPVTIPRAREGITTKQEQIHLARDQIGPYKKAEAVATVVAAVDQARVREPWEVE
YAEEGYAEQTALGYEYKERTTAGHIVEVPAEHHVVTKPVHVPSETKVSTAEKMGMHISTQ
IKRTEEARTEKAVLVEHTRPRTASPHFTVSKITVPKPDHTYEVSIAGSAMATLEKELSAT
SVQKITRSVKSPQVKPHETRMMTEKVVSPQFPFGEAADAYKSRYDVETKRDISVSITGGV
VREEHIELMQEGETKVTETARVPEPAEVPAAPPTLVSGLKNMTVIEGESVTLECYISGHP
APTVSWYREDYQIESSIDFQITFKAGVARLVIREAFAEDSGRFTCTASNSAGTISTSCYL
HVQVSEEIESRETVSAKAVTEEKRYVESKDVVMVDTTVTEQEMFGEAAAPYFLTKPVVQK
LVEGGSVIFECQIGGNPKPHIYWKKAGVPLSTGYRHKVSYKKETGECRLEISMTFADDAG
EYTIVIRNKHGEASASASLLEEADYEVYLKLQQEMMYQTQVTAYVQEPKVAEIAPAISYA
DYEKEYEKEQALIRKKMAKDTVQIRTYVDEQEFHISSFEERLIKEIEYRIIKTTLEELLE
EDREEMVVDVPESETVEAGFDLGLKNYRIFEGMAVTFHCKMSGYPLPKIAWYKDGKRIKH
GERYHMEVLQDGRASLNLPVVLPEDEGIYTVFASNVKGNAICSAKLYIEPVAPVGAPGYM
PAPDVMKRYRSLSPRSPSRSPARSSPSRSPARRLEETDEGQLERLYKPVFVLKPSSFKCA
EGQTARFDLKVVGRPMPETYWFHNGQQVVNDFTHKIVVKEDGTQSMIIVNTRPDDSGEWT
VVAQNRAGKATISMTLTVEAQEHLVKPHFVERLKNVSVKEGAKLKMAVKATGNPNPDIVW
LKNSDIIVPHKYPKIKIEGTKGEAALKIESTVKHDAAWYTATAINKAGRDTTRCKVNVEV
EFAEPEPERKLIIPRGTYKAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKL
TSLRLKCFGPAHFDCRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYP
RDSGVITCRASNKYGADHTSATLIVKDEKSLVEETQLPEGRKGLQRIEEMERMAHEGALA
GVTEDQKEKQKPEIVLVPEPARVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRL
RYDGIYYLDIVDCKSYDTGEVKVTAENPEGVTEHKVKLEIQQREDFRSVLRRAPEPRHEP
AAAEPGKLLFQVQKVDKPAETTTKEVVKLKRAERITHEKLPEETEELRSKFKRRTEEGYY
EAITAVELKSRKKDEAYEEMLKKTKEELLHWTKELTEEEKKALLAAGEFTVPAVKPDKLG
LSPSMEAPKILERIQSQTVAQGSDAHFRVRVVGKPDPECQWFRNGVQIERSDRIYWYWPE
DNVCELVIRDLTAEDSASIMVKAINIVGETSSHAFLLVQAKQLINFTQSLQDVVAKERDS
MATFECETSEPFVKVKWYKNGIEIFSGDKYRMHSDRKGHFLSVLMIDVSDAEDYSCTLVE
DETVKTTAKLIVEGAIIEFVKELEDIEVPESFSGELECEISPEDVEGKWYCGDVELTSNS
KYVITSRRGRQILTVKDVSKEDQGEYSFVVDDKKTSCKLKMKPRPVTILQGLTDQKVCEG
DIVQLEVKVSLENVEGVWMKDGIEIQPNDRVHVVLDKQSHMLLVEDVTKEDSGNYSFNVP
SLLLSTTGRVSVYSVDIVVPLKDVHSIEGTKAVFECKVSVPDVSSSKWYLNDQQISPDDR
IQAVCKGTKQRLVLVRTHASDEGHYKLMVGKVETSCNLIVEKIQIIRGLHDITCTETQNV
SFEVELSHANIDVLWHFKDQELNASLKYKIEARGKIYKLTVVNMMKDDEGEYTFCAGEKK
TSGKLVVAGGAIAKPLTDLTVAESQEAIFECEVANPDSEGQWLKDGKPLSMTDRFQSESD
GLKRILNIPVTTLDDMGEYTYKVASSKTSAKLKVEAVKIKKTLKNLTVTETQDALFSVEL
THPDVKGVQWIKNGIELKSDDKYEITVKENVYTLKVKNCVITDESVYSFKLGRLGANARL
HIETVKIIKKPKDVTALENATVSFELSVSHDTVPVKWFHKNVEIKSSDKYRMISQRKAHK
LMLQNISPSDAGEYTAVVGQLECKAKLFVETVHITKTMKNIEVPETKTASFQCEVSHFNV
PAVWLKNGVEIEMSQKFKIVVQGKLHQLNIMNTSSEDSAEYTFVCGNDRVSATLTVNPIL
ITSMLKDINAEEKDTITFEITVNYEGITYKWLKNGVEIKSTDRCQIRTKKLTHSLAIRNV
HFGDAAEYSFVAGNAVSSATLYVEARHIEFRKHIKDIKVVEKKRAIFECEISEPDISVQW
MKDGQELQLGDRVKVQRERFVHRLLIPSTKMSDAGQYTVVAGGNMSSATLVVEGRDIRIR
SVRKDVQVIERQRAVIEFEVNEDDIEARWYKDGIEINFQIEERYHYVVERRIHQMSITET
RYSDAGEYTFVAGRNRSSIILYVNAPEPPQIIQELQPTTVESGKPARFCAVISGRPQPKI
SWYKDEQQLSPGFKCKFLHDAQEYTLLLIETFPEDAAVYTCEAKNDYGVATTSASLSVEV
PEVVSPDLEVPVYPPTLITPLRDVVTSEGQSACFQCRITGTDLKISWYCKDKEIKPSRFF
RMTHFEDTCQLEIAEAYPEDEGIYTFVASNSVGQVTSTANLKLEAPEKVLQEKIEQQIEM
EVKDFSSSVVVSAEEEGTQRYSSGLQLSDRNKTLECMPEKSVYSSKLEMKTEEGSVPVFL
KQVSNAEISLGDVAKLSVTVIGSPKPKIQWVFNGVKLTSSMDYKFVFDGNDYSLIILDTK
SEDEGEYMCIASNKYGETACSAYLKVKAKMTGGVYKKSAVVLEMEKPPEKKVSPHRPCFV
KKLEPAQCAQGLPVVFEYAVLGEPGPEVQWFKGDQQINSNDYYTVVHNPDGSGSLTVNKC
QSDDGGLYTCKATNPLGQATCSAELLVPLGTASGKEQHGGKPLAKSSEEPAGEQTEESSF
WRQEQEALCTVGPKDRQPVQSGEAAPLLEVSPSAASLQQETTLPWHAALLQAPRAEGCLD
VSPHTAEPAASTPKPLPPAAFTTSEVRKPLSLLEPRLEPIQSPPVAELPAPQRHGTPALC
VPVVQENSPQDKEPDLHPGAAEGNVLGAPGTRAPGGAAAAGGGGGQPVGEAHATELDALE
VPAEANPVQELPAPLHRPLTDSQKLCAKEGSWSAPAAAQYNGALAQERMVHAALLTEEKW
QLTGEHAHQVPGLDKLVAAEAQREGARLLNLPVVGGQTTLPKEEPCSFVELPEDHAAARR
SPTMLHALVWEERNALCGEKSGQFPALDGAMSVQPVKELPSALHLHTTHSEHVLPKEDIL
AFQKPVSHVAFQREEKMCNRAATAEEKRELSAEQLDGFRSSPEGIQPTALVEPQIQNCLA
TVAEDIPVPKEQIISATEKEQKAALRKEDSQTVMQLSSVMESRALADQSLDETFEENQTV
SGEVKSEPRFLSESVCTEERSVPLESANVLEAAQHDFAARIQEGQSVRLPLILEEKQPLQ
EEHAVELQRSETGTIKAEKQPKETLRAHEIEDREVLSKENQFVVQVPKSCSLDIKTQIRS
ALKAAITSEQLLLSSEWLSDIKNIEVTRVKVNKEPKYTMCTCLITIGSSSAIEITFFLEE
IYPQTVGLKTELKAALYSIIYEEKHILMAEQPRTMSVTMPQKLFITHAPFAEISSAAIAS
DQRCRCKHSHCRPCFGSCATGEISGDTDRETDEVLELQQGEITLESEAPLGQLLSARAVS
MVAVESQIRDVGANTVTADLALAAVPLEKSVETLTVKQKKEEISEDDGGEVLLTQAGTPE
GKLVRKDYPVIHRNLVDTIVEEGDSLSLVSVITNVQKVNWYFEGKLVSSGKQFKCSQDHD
TYTLVINKVHKEVHHGEYACEALNEGGKTTTSAKITVVKRVAPILRRRIESQEVAVNHLA
KFTCEIETAPNVKFQWYRAGREIYDSDKYSIRTAKYVSTLEIPRPQVVDCGEYSCKASNQ
YGSVSSTAILTVTEAFPPTFLTRPESITTFVGKSARFLCTVSGTPVIDTVWQRDGSAISS
SEHHKISAVDNKHILEIKHVTVNDRGIYTCKASNKFGADICQGEMIIIDKPHFIKELQSV
QSAVNKKIRLECQVDEDRKVSVVWNKDGNKIPPGKDYKIYFEDKIASLEIPLAKLKDSGN
YVCTASNEAGSSSSSATVTIREPPSFLKKVDPSYLLTPGESAHLQCKIKGSPEIQVSWFK
NNKEIRESNTYKMSFANSVAGLVISDVRVEDSGSYSCEAVNDAGSDSCSTEIVVKEPPSF
IKTLEPAEIVKGTNATLQCEVAGTGPFEISWFKDKKQIRSSKKYRVMSQKSLVFLEISSF
NSADVGEYECVVANEVGKCFCSATFILKEPPSFIKKVENVTALVGDTITLQSVVKGSATI
TVTWMKGKDIIKEDNKVKVTFENGLATLQITGVDISSGGKYTCVAENDAGSQTCFGELAV
KEPAQITEKPELIQVTAGDPAVLEYTVAGTPELKTKWFKDGKPLPSSKKYRISFKNNVAQ
LKFYTAEIQDSGEYTFEIANDVGGSSCTTTFTVLDRTIAPFFVKPLRNVDSVVSASCRMD
CKISGSLPMRVSWFKHEEELTTSAKYTVAFAEGSASLDIKHLDTNDSGMYTCRATNSAGS
KEGSCTLVVKEPPSFIVEPESQEVAPGSTVRLKSSLKGTPPLTIKWFKGASELETGGACY
IMTEALASYLELYAVKPSDSGDYTCQVSNVAGSVACSANLFVKEPATFVEKLEPSLLLKK
GDYVQLDCQVVGTKPIKITWFKGDREIHESDKYKMSFVGSKATLQLTEVAIEDSGEYICE
AKNDGGKDICSSVVSVKESPYFSKEFESLEVLKDSDVVLECQVLGTPPFEVFWLKDNKPV
RSSRRHRLSTEDSLISLHVFRFDASDVGEYQCRITNAVGSCVCSAEVTLKEPPQFVKKIE
NISSLRGGTAVFQAALKGSLPITVSWLKDNDDVIEDSNIKMTFVNNVATLLVRSIEVKHD
GKYFCQAKNDAGIQRCSALLTVKEPATITDKAVSIDVTEGDPATLQCRFSGTKDITAKWF
KDGKELTLGPKYKISVTDQVSVLKIIHTEKKDSGEYTFEVQNDVGSSSCTASMNVLDLII
PPKFTKKLKKMDSIKGSFIHLECIVSGSHPISIQWHKDGQEITASEKYKYSFHDNTAFLE
INQLEGADSGSYTCEATNKAGSNHCSGYLTVKEPPYFVEKPQSQDVIPNARVLFKALVNG
TTPMQIKWFKDSKELISGATRSVWKDDTSSVLELFSAKTSDSGNYTCQISNDVGTATSKA
ALFVKEPPKFIQKPSPVVVLRKGQSTTFECQVAGTPAIHITWYMDGNEITDPAKYDIAFV
DGFATFKVTSAKVEDSGIYVCEAHNDAGSESCSIELKVKEPPTFIRELKPAEVVKGFDAL
LECEVSGTPPFEVTWLKNNKEIRSSKKYAMSDKESVFTLVVTNCDFSDAGEYQCIISNDG
GSCSCSTKVSLKEPPSFIKKIENVTTVLKSSAVFQCTVAGAHPLTVSWIKDEKIIEEDEN
VHITFENNVATLKIKHIDIGHRGRYTCQAKNESGVEKCFALLLVQEAAQIIEKAKSVKVT
ERDPVTLECTVAGTPELKLKWFKDGKQLLPSRYYTMSFDNNVASFRIESVMKEDSGTYAF
KVENDFGSSTCESVLTVLDQTIPPSFTKKLTKIDQVLGSSVHMDCKVSGSLPITAKWYKD
GKELHDSAKYRSLCHENTVSMEILNLELADTANYTCSVTNVAGSDSCSAVLTVKEPASFL
VKPENQQAIPNSMVEFKAVLKGTPPFTIKWFKEDLELVSGANCYIGIEGSTGFLNLYSVD
ISKSGHYTCQVSNDVGSDSCTATLLVTEPPKFVKKLEASKVVKQGDSARLECKISGSPEI
RVVWYRNDSEIIASDKFRMSFSDSVAVIEMNHLSTEDSGDYICEAHNPAGRTSCSTKVIV
KEPPVFSRKPSPVDMLKGTDVSLECEISGTPPFEVMWYKDKRQIRSSKKYKVTSKNYHAS
IHILKVEASDIGEYQCKAQNDVGSDSCICTVKLKEPPKFVTKISSISVVIGEPVELQARV
EGSQPISVQWLKDKEEVIRESENTRITFVENIATLQLANAEPGSAGKYICQIRNDAGSRE
CMATLTVLEPAIIVEKAEPMRVTVGDVCTLECKVAGTPELSVGWFKDGKELTSSHKYKIT
VHNKVSTLKILDSEKGDSGIYTFAVQNDVGKSSCTASVDVLDRIIPPSFTRKLKDTNGVL
GLSALLECKVSGSPPISVAWFQDGNKIVSGEKHQTSFSDNLCVLQLNSLNASDTGGYTCK
ATNVAGSDECRAVLTVQESPSFVKKPEPVDVLPGTSVAFTSVIRGTPPFKVNWFRGVNEL
VPGYKCNISLEDSVAELELFDVDPLQSGDYTCLVTNDAGKASCTAHLSVKEPAVFVKKLS
DHCVEPGNPIVLESTYTGSLPISVIWKKNGKPITQSEKCNIVTTEKSCILEILNSTKEDE
GEYTCHVENEAGGDVCEALVSTLEPPYFVTQLGPLEVSVGDYTTLHCHVAGTPEITVSWY
KGDTKLRSTPEYKMFFKDNVATLVFNKVDSNDSGEYICKAENSIGTATTTALLTVQARKL
PPSFARKLKDIEQTVGLPVKFTCRLNGSEPISVAWYKNGVPLRDDHYVQTSFVENVAILQ
LSQTEMSHTGQYSCTATNAVGTATSSARLTVSEPKQPPSFDITPASLEVPSGESADFECH
VTGTQPINVTWAKDGREIRMGGNYNITFIANTAHLRILRAGKGDSGQYTCQASNEIGKNF
CSAQLNVKEAPKFVKKLEASRFVKQGDSVQLECKISGSPEIKVVWYRNDAEIHASEKYKM
SFSDSVAVLTVTDAGIEDSGDYICEAHNSAGSASCSTVVTVKEPPVFSKKPTPVETLKDS
DVVIQCEISGTPPFEVAWFKDRRQVRSSKKFKVTSKDFTASVHILNLETSDTGEYQCKAM
NEVGSDTCVCAVKFKEPPRFVQKLSDTVAFVGEPTTLQAVVEGSQPISVLWLKDKGDIIR
ESENVQISFMDNIAILELGSTEGANTGKYICQIKNDAGMRECSAFLQVLEPAVILEKPEP
MSVTAGNSFTLECTVGGTPELITKWYKDGRELQSGRKYQITFFNKVATLKVLSADGGDRG
LYTFEVRNEVGESSCTSSVDVSDRIAPPFFTRKLKETYGILGSSALLECKVSGSAPISVA
WLQDGNEIVSGDKYEISFSDNVCRLKLNALDASDTGPYTCVATNVAGSDECSAFFIVQEP
PSFAKTPDPVEVLPGMSVTFTSLIKGTAPFKVNWFRGIRELVSDSTCNISLEDTVAELEL
YEVEPFHSGDYTCRVTNDAGSVSCTTHLFVKEPATFVKKLSDFSVEQGKSILLESTYKGT
PPISVTWKKNGIPLTQSPRCSITSTEKSGILEIPSSTKDDEGEYTCEVANDAGADLCQGL
ISILEPPYFVTHFERVEVTVGESATFQCQISGTPEIKVSWYKDDTKLRSTPAYKMYFKNN
VATLVFNKVESSDLGEYVCRAENSVGFASSTALLTVKDRKFPPTFAKKLKDIHETVGSPI
TFDCRINGSEPIEVSWHKDGELLHDDENTQTTFLNNVATLQILQTTMTHCGQYSCSAQNA
LGSASSSGRLLLTEHLRPPVFDVKPVPIEVALGASGSFKCHVTGSAPLKVTWAKDNRDIR
PGGNYKITLVENIASLTVLKVGKGDAGLYTCYASNNVGKDSCAAQLSVKEPPRFIKKLDS
SRVVKQHDSTRYECKIGGSPEISVTWYKNETEIHDSEKYRMSFIDTVAVLDMHNLSVEDS
GDYTCEARNAAGAANTSTSLKVKEPPAFSKKPHPVETLRGSDVHFECELQGTPPFQISWY
KDKREIRSSKKYKIMSENYLASIHILSVGDADIGEYHCKAVNDVGGDTCVSTITLRAPPI
FVKKLSDVTAVVGEEVELQATVEGAQPISVLWMKDKGDIVRESENLGISYSENVASLRIG
NAEPASAGKYICQIKNDAGVQECYATLSVLEPAVIVEKPSPMKVTSGDSCTLECTVDGTP
ELTARWFKDGNELSTDHKYKISFFNKVSGLKILDARVEDSGEYTFEVKNSVGKSSCTASV
RVSDRIIPPSFTRKLKEANGLLGSSVVLECKVYGSPPISVSWFHDGQELTSGDKYQTALT
DNACSLKVNALEESDMGTYSCTANNVAGSDECSAYLTVREPPSFVKKPDPLQVLSGANIT
FTSILQGTPPLDVKWFRGSVELLPGHTCNISLEKSVAQLELYGVQPHQSGDYSCLVTNEA
GKVSCTTQLFVKEPAKFVKKLNNLSVEKGKSLILECTYSGTSPIAVVWKKNGFEIAHSEK
CSMTTTETSAILEVSSSTIEDQGQYTCNIENDSGLDLCKADVSVLEPPYFVTRLEPAQVT
VGDSVSLQCQVAGTPEITVSWYKGDTKLRATPTSKMHFKNNVATLVFSQVDTGDSGEYIC
KAENSVGEASSSALLSVQERKLPPSFTQTLRDIHETVGLPVTFDCGITGSEPIEVSWTKD
GAPIREDYTVQMSFLNNEATLQFLQTDKSLAGQYTCTASNAIGTASSSARLVLTEGKNPP
LFDIPIASMDAFAGESADFECHVSGSQPIKVTWAKNNEEIRTGGKYQISYVENIAHLTIL
NADNSDSGTYTCQASNEVGKDSCTAQLSIKERKIPPSFTKKLSEAVEETEGNTLKLEGCV
TGSQPLTVAWYKNNQEFYQSANCEISFQNNIILLLIKSAGQADAGLYTCKVSNEAGSVLC
TSSVIIKEPAVILEKPEPMSVTEGDSFTLECTVGGTPELITKWYKDGRELQSGRKYQITF
SNKVATLKVLSADGGDRGLYTFEVQNEVGKSSCTSSVDVSDRIVPPFFTRKLKETYGILG
SSALLECKVSGSLPISVAWFHNRKEIVSGDKYEISFSDNVCGLKLNALDTSDTGPYACVA
ANVAGSDECSAFFIVKEPPSFVKTPDPMEVLPRMRVTLTSLIKGTAPFKVNWFRGTRELM
SDSTCSISLEDTVAELELYEVELFHSGDYTCRVTNDAGSVSCTTHLLVKEPATLVKKISD
FGVEQGKSILLQSTYKGTPPISVTWKKNGFPLTQSPRCAITSTEKSSIVEILNSTKDDEG
EYACEVANDAGADLCQGLISILEPPYFVSHLERVEVTFGKPASLECQIAGTPEIKVSWYK
EDTKLKSTPTYKMYFKNNVAKLVFSRVESSDLGEYVCKAENNVGFASSTALLTVKDRKFP
PTFARKLKDIHETVGSPITFDCRINGSEPIEVSWHKDGELLHDDENTQTTFLNNVATLQI
LQTTMAHCGQYSCSAQNALGSASSSATLLLTEHLRPPVFDVKPVPIEVALGASGSFKCHV
TGSAPLKVTWAKDNRDIRPGGNYKITLVENIASLTVLKVGKGDAGLYTCYASNNVGKDSC
AAQLSVKEPPRFIKKLDSSRVVKQHDSTRYECKIGGSPEIKVTWYKDETEIHDSEKYRMS
FIDTVAVLDMHNLSVEDSGDYTCEARNTAGTANTSISLKVKAPPVFSKKPHPVETLKGLD
VHLECELRGTPPFQITWYKDKREIRSTKKYKIMSENHLASIHILSMSDADVGEYHCKAVN
DVGSETCICFITLKAAPIFVKKLNDVTAVVGEAVELQATIGGAQPISVLWMKDKGEIVRE
SENNWISYSENIATLRIGNATPATAGKYICQIKNDAGVQECFATLSVLEPAVIVEKPGPM
KVTSGDSCTLECTVDGTPELIAKWFKDGKELSTDHKYKISLVNKVSVLKILNAGIQDTGE
YIFEVKNSVGKSRCTASVRVSDRILPPSFTRKLKDINGLLGSSVVLDCKVSGSPPLSVSW
FHDGHEITGGDKYQLTLTDNTCSLKVSTLEESDKGTYSCTANNVAGSDECSAYLTIREPP
SFVKKPDPLQVLSGANITFTSILQGTPPLDVKWFRGSVELVSGHRCNISLENSVAELELF
DVLPLQSGEYTCLVTNEAGKVSCTTQLFVKEPAKFVKKLNNLSVEKGKPLILECSYSGTP
PIAIVWKKNGIQIVHTAKCSITTTETSAILEVPSSTIEDQGQYTCHIENDSGQDICHSTV
SVLEPPHFVTRLEPAQVTVGDSVSLQCQVAGTPEITVSWYKGDTKLRATPTSKMHFKNNV
ATLVFSQVDTGDSGEYICKAENSVGEASSSALLSVQERKLPPSFIRTLRDIHETVGLSVT
FDCRITGSEPIEVSWSKDGAPIREGYNVQMSFLNNEATLQFLQTDKSLAGQYTCTASNAI
GTASSSARLVLTEGKNPPLFDIPIVSMDAFAGESADFECHVSGTQPIKITWAKNNEEIRT
GRKYQISYIENIAHLTILSVDSSDSGTYTCQASNEVGKDSCTAQLSIKERKIPPSFTKKL
SETVEETEGNALKLEGRVSGSQPLTIAWYKNNQEIYQSRNCEISFQNNIILLQIMSAGQA
DAGLYTCKVSNEAGSVLCTSSVVIKEPKKPPVFDQPLRPVTIAEEDILQLSCHVQGSQPI
RIQWLKAGKEIKASDKCNISFADGTALLELTAVTKTDAGEYMCKATNVAGSDSCKSKVTV
KEKPAAAPAVKKAPVDGKLYFISEPQNLKVVEKSVATFIAKVGGDPIPNVKWTKGKWRQL
NQGGRIIIQQRGNEAKLEIKDATKTDSGQYRCVAFNDHGEIESSANLQVEERRQEVIEGD
LRAKLKSTPTKKKEEEEEEKPIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQ
SQEEESHRLEIEVTERARKEEQEFDELVSFIQQRLTQTEPITLIRDIENQSVVANEDAVF
ECEIKINYPEIKLSWYKGTQKLDPSNKYEIRIKGDRHILRIKNCQPTDQGNYRIVCGPHI
ASAKLTVIEPPTIITKLDFSRVVKQHDSTRYECKISGSPEIKITWYKNETEIDDSEKYRM
SFIDSVAVIEMHKLSVEDSGDYICEARNAAGAASTSTSLKVKAPPVFSKKPHPVETLKGL
DVHLECELQGTPPFQISWYKDKTEITSSKKYKIMSENYLASIHILSVDAADVGEYHCKAV
NDVGSDTCICFIALQAPPIFVKKLSDVTAVVGEAVELQATVDGSQPISVLWMKDKGEIIT
ESENLRISYSENVATLRIGNATPATAGKYICQIKNDAGVQECFASLSILEPAVIVEKPGS
MKVTSGDSCTLECTVDGTPELSARWFKNGKELSTNQKYKISFINKVSGLKILNAKVEDSG
EYTFEVKNNVGKSRCTASVRVSDRILPPSFTRKLKDINGLTGSSVMLDCKVSGSPPFSVS
WFHDGHEITSGDKYQTTLTDNTCSLKVNALKESDMGTYSCTASNIAGSDECSAYLTVREP
PSFVKKPDPLQVLSGANITFTSILQGTLPLDVKWFKGSVELVPGHTCNISLENLVAELEL
FDVQPHQSGDYSCLVTNEAGKISCTTQLFVKEPAKFVKKLNNLSVEKGKPLILECTYSGT
PPIAVVWKKNGFKVVHSAKCSITTTETSAILEVPYSKIEDQGQYTCHIENDSGRDLCQAD
ISVLEPPYFVTRLEPVQVIVGDSASLQCQVAGTPEITISWYKGDTKLRATPTSKMYFKNN
VATLVFSQVDIGDSGKYICKAENSVGEASSSALLSVQERKFPPSFTQTLRDIHETVGLPV
TFDCGITGSEPIKVSWTKDGVSIRDGYNVQTSFLNNVATLQFLQTDKSLAGQYTCTASNA
IGTASSSARLVLTEGKNPPLFDIPIASVDAFAGESAEFECHISGTQPIKVTWAKNNQEIR
SGRKYQISYVDNTAYLTILNVDNADSGTYTCQASNEVGKDSCTAQLNIKERKIPPSFTKK
PSETVEETEGNTLKLEGRVSGSQPLTIAWYKNNQEIDESPNCEISFLKNTIVLQIKSVGQ
ADAGLYTCKVSNEAGSILCTSSVVVKEPKKPPVFDQPLRPVTIAEGDILQLSCHVQGSQP
IRIQWLKAGREIKASDKCNISFADGTALLELTAVTKTDAGEYVCKATNIAGSDSCKSKVT
VKEKTAAAPAAKKAPVDGKLYFISEPQNLKIVEKSVATFIAKVGGDPIPNVKWTKGKWRQ
LNRGGRIFIQQKGNEAKLEIKDATKTDSGQYRCVAFNDHGEIETSVELQVEERRKEEAIE
GDLRAKLKSTPTKKKEEEEEKPVDIMEILKNVDPKEYEKYALMYGITDFRGLLQAFELLK
QSQEEESQRLEIEVTERTLKGEQDLEELVSFIHQRVTQTEPVSLIMDIENQTVLADEDAV
FECEIKINYPEIKLSWYKGTQKLDPSDKYEIRIKGDQHILRIRNCQPADQGNYRVVCGSH
IGSAKLTVIAPEVERNLHDTAFKEGRTCTLICQFSIPNAKSQWYRNGKAIKIGGRYSTQV
SEKTHKLIIKDVRTEDQGQYTCKLHNLETTADLTIEAEPIQFTKSIQNIVVSENESATFE
CEVSFDDAVVTWYKGSIELRESRKYSFRSEGRCHYMTIHNVTAQDEGVYSVIARLEPRGE
ARSTAELYLTTKEMKLEVKPPDVPDARVAVPIEAPAEDIPIPVLLPFTVPPPEDKKETKK
VLEKKVSKKVVSKVPEEITPPKVPKVPKDRQEIKITSEARREEVHEKEEIYKKREEVYEQ
KEEIYEEQKEPYEEWEEDYEEEQEYYEREDYEEGEEEWETYEEKQVYREEVIGVPQKPVP
EHITPEITAEKKKKEVTVHKVVRKPVAEEVEMTTQRLEEEEVRLPKVPAVPKKVPPPKPT
RVPVEEEEITRKKVPTVEMWTISEEKMSVSVHAEEEYSYVPEPKVHERTVIEEKVHVEIP
EAPPVPVPEVRKREEKKIPAAVPKKVEAPPVKVPEVPKKTVPEKKEPVPVPKKVEAPPAK
VPEVPKKLVPEKKVPAAVPKKEVAPPAKVPEVPKRPAPEEKVAVPKREEAPPAKVPVVPK
RAVPEEKLPVAVPKKVEAPPAKEPTVQEWIEEEEEEEEMVTFVHRKEEISSITVLKKKPP
DEWIPPVPIEIEEPQFTKVSEVHTKIITEEKVAMAEKQAAPPKKVPKVPQKSVPGDKVLI
PVHKKVVTPLAKNISALSGDTGDFYISKFSENQQALDLSSPRAAKVEEHWALSEDVSISL
HTEEQVSYTVSEIPERVVIEEVLPISISKKVKKPPIKVAEEEPCYVEEEVPVVVPKKVEA
PPVRVLKKKPPEEWVPPVPIEIEEPQFTKVTEVHRKIIIEEKVAMPEKEEAPPKRVPKVP
KKAVPEEKVPVPIHKKVVAPPAKVAEEEPSYIEEEVPVPVPKKVEAPPAKVPEKPKKVVP
PPKVPAAPKIEEAPPAKVPEVHKKAIPEEKVPVPVPKKVEPPPARALKKKPPEEWIPPVP
IETEEPQFTKVTEVHRKIVIEEKVAMSEKEETPPKKVPEVPKKPVPEEKVPVPVQKKAVA
SPAKVPEVPIAVPKKTAAPPAKVEEHWALSEEVSISLHTEEEVSYTVPDVPEKVVIEERL
PISITKKVKRPPVKVPEERKTVVQKEQIYVEVPQYEEEEVTHYEEEEKVTQYEEEEEEEE
VTLYEEEVTQYEEKVPQYEEEEEEVPEYEEEAPPPVKVPEVPTRRIPEEKVPVPKRKEAP
PAKVPEMPQKPVPEEKLPVPVPKRKEAPPTKVPEKAVPEEKVPVPEPKKVEAPPAKVPAV
LKKAVPEEKVPVAVPKKPEPAPVPKKSEPPPPPKVPEVPKKAVPEEKVPVPKVKKAPSAK
VPEVPKKPVPEEKIPVSVPPKMEPPPAKVPEVPKKSVPEEKVSVPKKVEAPAVKVPKKPK
EVVPEEKIPVAPLKKVELPAVKVPEVQKKAVPEEKVPAAVPKPKEAPPAKVHEVPKKPSW
EERISLPVPAEKEYEYEYEKYETYEAIEEFEIPEHEDIEYEELPEPEEIYEEAPEPEEIY
EEVPEPEEIYEEVPEPEEKYEQIRVTEEVYEEVKKVEEIFEEAYEVTPAIVPKVPKRSVP
EEKIPVAVPKKEAPPAKVPAVRKKPVPEEKVPVAVPKKEVPPPAKVPEVPERVVPEEKAP
TLIPREEETAPYEVPAVPKKAVQQKKIPAAISKKEAPPITESVVPGRAVSPEKKPTVVPK
KEDALPAKVPVMPKKSVPKKKVPIAVPNEEAPPFKVPEVYEEIPPEEKISTAIPRKEESP
QITVPDVSKKAIPEGKVQIAVPKKTEPPPAKVPEVPKESVPEEKVPIAVSKKPEAPPAKV
PEVPKKAIPEEKVQIAVPKKAVPKKTERPTAKVPEVPKEPVPEKKVPVAAPKKPEVPPAK
VPEEPKKAVLEEKIPVAKKPVPPAVKVPEVPKEVPKEKEPVAVPKKPDAPLAKVPEVPKK
AAPEEKVPVTVPKKPEAPPAKVPEVPKKVVPEEKLPVAVPKKPEPPPAKVPEVPKKVVIE
EKVPVEEPEKPEPPPAKVPEVSKKEVPKKKVPVAVPKKPEPPPAKEPEMPKSAVPEEEDF
LAVPKKTEPPPAKVPEVPKKAVPEEKIPLAVTKKPEPPPAKVPEEPRKTVPEEKVPVPKK
EEPTPVPKKPEPPPTKVPEVAKKDVLEEKVTVPKKPEPPPAKVPEVPKKDVSEEKVPVPK
KPEPPPAKVPEVSKKAVPEEKVPVPKKIEPTPVPKKPEPPPAKVNRTNIFKVPGVPKKDV
LEQKVPVPKKTEPPPRHLNSTNIFKVPGVPKKAVPEEKITVPKKPKPTPVPKKPEPPAAK
VPEVPKKVVPEEKLPVAVPKKPEFAPAKELEEISLAEEEEISAAEEEISAAEEEEISSEE
ISPAEEEISAVEEIVPIEEPEPEKKIPEKPKPRVPLPPKEEVKMEKVQLKAPTPRKKVVP
EKPVQAPEKVELTPAKVPGVEKKGRRILPEVTPPPKEEVVLKRVPRKTPEEEKPKPEKEP
KVETKPEPKPVEKIKKPEEPEVPKKKIEIPPVTKKEKPVPEPEKVPEPKPAAVPLPEPKP
TEALISPKLAEEAAPVTAPVTTPVVGKKADPKAPKEEPGKVRTPIKAKKTPSPADLDRKK
LRPGSGGEKPPEEPPFTYQLKAVPLKFVKEMKDIVLEEAESVGSSAIFEVLISPSTAITS
WMKDGNNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLIVEEI
PVRFVKTLEEQVTVVKGQPFYLSCELNKERDVVWRKDGKIVVDKPGKYALGIIGLQRALT
IMDADDADAGTYTVTVDNTDLKCDSVVQVIEVIRDWLVKPIRDQHVKPKGTATFVCNMVK
DTPNFKWYKGDEEIPTEPTDKTEIVKEGNLIHLKVKNATPEDIGEYAIEIEGRRYAAKLT
LGEREVELLKPLEDVTVYEKETASFDTEISEEDIPGEWKLKGEILRPSPTCEIKSEGGKR
FLTLHKVKLEQAGEVLYQALNALTTAILTVKEIELDFAVPLKDVTVPEKRQARFECVLTR
EANVIWSKGTDIIKVGDKFDIIADGKKHILVVNDSQFDDEGEYTAEVEGKKSTARLFVEG
IRLKFLTPLKDQTVKEGETAHFEFELSHENMLVSWFKNDKKLHTSRTVLIHAEGKIHKLE
MREVTLDDISEIKAEVKGLHTSAKLRVLEADPYFTVKLQDYSAIEKDDVILECELSKDVP
VKWYKDGQELTASKRISIKTEGLRRILKIKKIEDGDKGNYECDCGTDKTKANVNIEPRII
KVERPLYGVEVFVGETARFEVEISEPDVHPIWKLKGETLAPSPNCEIIEDGKKHVLILYN
CKLDMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVKVFEKDEARFECEVSREPKTFR
WLKGTQEITGDEKFEIISEGTRHALVIKTVAFEDEAKYMFEAEDKRTSAKLIIEGIRLKF
ITPLKDVTAKERETAEFTVELSHDNIPVAWFKNDQRLHTSKVISMKDDGKFHTLTIKDLS
IDDTSQIRVEAMNKSSEAKLTVVEGDPYFTAKLQDYTAVEKDEVILQCEISKADAPVKWL
KDGKEIIPSKNVVIKADGKKRILILKKALKKDIGSYTCDCGTDQTSAKLNIEERDIKIVR
HLYSVEVIETETARFDTEISEEDVHASWKLKGETLNQSPECEIKEEGKKHFLVLYNVRLD
QAGGVDFQAANAKSSAHLRVKPRVIGLLRPLKDVTVTAGETATFECELSYEGITVEWFLH
GQKLEPNDKVVTRAEGRVHTLTLRDVKLTDAGEVSLTAKDFKTQANLFVKEPPVEFTKPL
EDQTVEEEATAVLECEVSRENAKVKWFKDGQEIHKTKKHDIIAEGRVRKLIIHGCTLDDA
RTYTCDAKDFKTSCFLNVEPLRVDFTKPLTDLEVKEKEIARFECEISRPNVKVRWFKDGV
EIRKGKKYDIISKGAQRILVINKCLFEDEAEYACEAKTARTSGILTVIEEEAVFTKNLPN
IEINETETVKFICEVSKPSAEVTWFKGDKELPEVGRYEQIADGRKRILIIRNARLDDAGE
YNCRLPSTRSTGKLKVHELAAEFITKPQNVEVLEGQKAEFVCSISKDTFEVQWLRGNKEL
EAGDKYDIISDGKKRFLIIKDSILEDEGKYSVMVSGIKATAHLKVIEKLRIITPLKDQVI
KEGEELVFNCEVNTEGAKAKWYKNEEPIFDSPKSIMVQKDLVYTLRIRDAHFADQATYTV
SLSNARGEHVKSSATLTVHEEDLKIVVPLEDIETMEKKSVTFWCKVNRLNVTLQWTKNGE
EVTLDRRILYKVDKYKHSLIIKDCGFIDEGEYTVTAGQDKSVAELIITEAPADFIEHLRD
QTVTEFDDAVFTCQLSKEKASVKWYRNGREIREGKKYLFEKDGNLHRLIIKDCRLEDECE
YSCGVDDRKSRARLFVEEIPIEIIRPPQDIYEAPGSDVIFMAELNKDGVEVKWLRNNMII
VQGDKHQMMSEGKVHRLQVCEIKPRDQGEYRFIAKDKEARAKLELAAAPRIKTGDQNLVV
DVGKPLTMIVPYDAYPKAEAEWVKDEESLPTQTVDTTADSTTFKIFEAKKSDKGRYKIIL
QNKHGKAEAHINVDVIDVPGPVRNLEVTETYDGEVSLAWEEPESDGGSKIIGYVVERRDV
KRKTWILATDHAESCEYTVTGLQRGGVEYLFRVRAKNRVGTGEPVETDTPVEAKSKFDVP
GPPLNVEVIDVNRFGASLTWEPPEYDGGSPITGYIVELRDKGSIRWEPAMTTGAHELGVT
MTDVVENKEYYFRIRAQNQIGVGKPSAATRAVKIMDPIEKPSPPINLSHSDQTKSSVQLT
WEPPLKDGGSPIMGYIIERREEGTDNWIRCNPRLVPNLTYKVTGLKPGASYYYRVSAENA
AGVSDPAEAIGPLTADDTYVGPTMDLSAFKDGLEVIVPEPLKIRVPITGYPVPTATWSVG
DKILEKGDRVKIETSAAFAELIISPSERPDKGIYTLKLENPVSSISGEIDVNVIARPSAP
RELKVIDMSRNTVQLTWEPPENDGGSPVTGYLIEKRDISRKTWTKVLDNVVDQDFTVPDL
IQGKEYLFRVSARNKCGPGEPAYIDEPINMSAPTTVPDPPENVKWRDPTSKSIFLSWDPP
KYDGGSRIKGYLVEKCQRGTDKWEPCGEPVAETKMEVPKLKEGEWYSYRVKALNKHGASK
PSKPTDEIQAVDTKEAPEIFLDVKLLAGLTVKAGTKIELPATVKGRPEPRITWTKADKIL
RPDDRIKIETKPNHSTVIIADSKRSDSGTYIIEAVNSSGRATAVVEVNVLDKPGPPAAFD
ISDITNESCFLTWNPPRDDGGSKITNYVVERRATDSEVWHKMSSTIKGTNFKATNLISQK
EYIFRVSAENMYGVGEPAVHSPIIAKYSFDPPGPPTGVTPSEVTKDSVTLTWCEPDEDGG
SPITGYWVERYDPDHDKWIRCNKIPVKDTTFKVKGLINKKKYKFRVLAENLAGPGKPSKE
TEPVLVKDPIDPPWPPGKPTVKDVAKTSLFLQWTKPEHDGGAKIESYVIELLKTGTDEWV
RVAEGVPLTEHFLKGLMEKQEYSFRVRAVNKAGESEPSEPSDPVLCKERLHPPSPPRWLE
VINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDIKYTVTPLTEGS
LYVFRVAAENAVGQSDYCEIEDSVLAKDTFTTPGPPYALTVVEVTKRHVDLKWEPPKNDG
GRPIQRYVIEKKEKLGTRWVKAGKTPGPDCHFRVTDVIEGTEVQFQVRAENEAGCGHPSE
PTDLLAILDPTSPPSPPLDLHVTDASRKHISIAWKPPEKNGGSPIIGYNVELCEAGTEKW
MRVNSRPVKDLKYKVEEGIVPDKEYVLRVRAVNAIGASDPSDISENVVVKDSDCNPTVDL
KTKDIIVVEGEKLSIPVPFRAVPSPTITWHKDGKEVKIGDRTTTKSDYTSTLLEVTNSVH
ADAGVYTITLENKLGSTTGSVNVKVIGLPGQCKNIKASEVTKNSCKISWEPPDFDGGTPI
LHYVLERREAGRRTYIPVMSGENKLSWNVKDLIPNGEYYFRVKAVNKIGGGEYTELRNPV
IAEDPKQRPDPPIDLEIHNPTSKSVTLTWKPPLYDGGCKIMGYILEKLPKGQDKWERCND
HLVPVLTYTVKGLEEGKEYQFRARAENAAGVSEPSRITPLVKAVDPIEVPKVFLAANLQA
GLEVKCGNEIALEAHISGSPYPSITWLRNDEIIRPEEIKKRVTKFTRRKKGEVEEEEPFY
LSLTERLNIDNHTQGESLLAVRDSIRRDYGTFTIRVENDHGVAKASCEVNVLDTPGPPIN
FTFEDVRKHSVVCKWEPPLDDGGSEILNYVLEKKDNSKAEIGWVTITSTLRHCKYHVLKL
IEEKEYLFRVTAENRLGPGPPCVSKPLVAKDPFSPPDAPDKPDVVDVTSNSMLVKWNEPK
DNGSPILGYWIEKREINSTHWARVNRNLLNVLEIRADGLLEGLTYIFRVCAENAAGPGKF
SPPSDPKTAQDPILPPGPPIPSVVDTSSTAIELEWEPPAYNGGGDITGYFVYKQLVGINE
WSRCTEKSIKIRKYTVKGIREGADYKLRVTAVNAAGEGPPGETEPVTVSEPQEPPHVELD
VSVKAGIQIMAGQTLTIPATVTGRPTPTIVWTVEEGELDKERVVIENVGTKSELTIKNAL
RKDHGRYMITATNESGSKFAATRVEVFDVPGPVLDLKPVVINRKMCLLNWSDPEDDGGSD
IIGFLIERKDAKMHTWRQCIDTERSKCDITGLVEGQEYMFRVIAKNKFGCGPPVDLGPIL
AVDPLGPPTSPERFMYTERTKSTITLDWKPPRNDGGSPIIGYIVDKRRHDSDVFERVNQK
LCPTTSLLVEDLAELHMYEFRVKAVNAIGESEPSLPLNVVIQDDEVSPTVTLRLAVRGDT
IRVMAGEXXXXXIEWAKNEVVIEKPLDGLKITKKEINRSEAKTEVSMPAAVRDDKGTYTV
TASNRLGTAYRNAYVEVYDRPSPPRNLAVSDIKAESCYLTWDAPLDNGGSEITHYIIEKR
DASRKKSEWEEVSATVVDRRFGVWKLATNGEYQFRVRAVNKYGTSDECLSEKVVIKDPFG
LPGPPGKPKVLDHTRSSMLVTWEPPLDNGGSPITGYWLEKREVGGVYWSRVNRAPVTKPV
MKGLEFNVLRLIEGVEYQFRAMAVNIVGIGPPGEPSDPALAADPIFVPGAPSCPEVTDKT
KSTIAFKWKPPQKDGGSPIKGYIVEMQEEGSPDWKKVNDQDKLFPTCECVVPNLKELRKY
RFRVKAVNAAGESEPSLPTSEIPVKEILEEPEIFIDIGAQDFLSVRSGTTIKIPAIIKGR
PVPKTSWEFEGEAKKAIKDGVNNIPEDAQLEVTDTTSIITIPECNRGHSGRYSITARNKA
GQKTVNVRVNVLDVPGPPKDLKVSDITRCSCKLSWKMPDNDGGDRIKGYVIEKRTVEGKA
WTKVNPDCGSTSFVVPDLIAGQQYFFRVRAENRFGIGPPADTIQRTTARDPIHPPDPPIK
LKIGLVTKNTVSLTWKPPKNDGGAPVTHYNIXXXXXXXXXXXXXXDVEETKFTVEDLKEG
EEYEFRVKAVNEAGPSRPSATAGPIIVKDQTCPPSIELKEFIEAEEGTDINIVAKIKGVP
FPTLTWFKAHPKKPDDKIPVLYDQHVNKVVSEDTCTLLIQQSRRRDTGLYSLNAVNNFGA
DSKTMRLNVLGLPGPPEGPIKFESISADQMTLSWLPPKDDGGSKITNYVIQKREANRRTW
VPVTNEPKECIFTVPKLLEGHEYMFRIMAQNKFGIGEPLDSEPQTARNLFTVPGQCDKPT
VSSITHDSMTVNWEEPEYDGGSPVTGYWLERKETTGKRWTRVNRDPIKPMTLGVSYKVTG
LIEGSDYQFRVFAINAAGVGPPSMPSDPAIARDPIGPPGPPFPKVTDWTKSSVDLEWAPP
LKDGGSRITGYIVEYKEEGKEEWEKVKDREIRGTKFVLAGLKEGSFYRFRVRAINAAGIG
EPGEVTEVIEMKDRIVPPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWSREERA
LPEEAKIEETAISSSMVIKNCKRSHQGLYTLFAKNAGGERRKTIIVEVLDVPGPVGVPFL
TENLTNDSCKLTWFSPEDDGGSPITNYIIEKREADRRAWTPVTYTVTRQNATVQGLIEGK
PYFFRIAPENIIGMGPFVETTKEIVIREPISVPERPEDLEVKAITKDSVTLTWNPPKYNG
GSDITMYVLESRLIGKEKFHRITKEKMLDRKYTVEGLKEGDTYEYRVSACNIVGQGKPSF
CTKPITCKDEIAPPTLELDCRDKLIVRVGEAFSMTGHYSGKPAPKVTWLKDEITVKEDKR
TKIQTTPTTLCLGILKSIREDSGKYCVIVENSSGSRKGLCQVTVVDRPQPPVGPVIFDEV
HKDHMFISWKPPLDDGGSEITNYIIEKKDANRDLWMPVTSANVKTTCKIPKLLEGREYVV
RIYAENLYGISDPLVSDEMKAKDRFSVPAAPEQPIIKDVTKDSALVIWNRPHDGGKPITT
YILEKKETMSNRWTRVTKDPIFPETQFRVPDLLEGCEYEFRVSAQNEIGVGDPSPPSKPI
FAKDPIVKPSPPINPEAVDKTKNSVDLSWHPPRHDGKGKIIGYLVEYQKVGDEDWKKANL
TADSCPETKYKVTGLTEGLIYKFRVMAVNAAGESEPAYVPDPVEVKDRLEPPELILDANM
AREQLVKAGNTLRLSAVIKGVPFPKVSWKKEGQEVSPKADIEVTGVGSKLEIRNTVHEDG
GIYSLTVENPVGSKTVSVKVIVLDKPGPPRNLQVSEVRRDSCYLTWKEPEDNGGSVITNY
VVEKKDVAAAQWVPVSASSKKHSHLAKHLMEGTQYLFRVAAENQYGRGPYVECLKPIKAM
DPLHTPGPPKNLHHVDVDKTEVSLVWNRPDRDGGAEITGYLVEYQEEGAEEWIKFKTVPM
LECVVTGLKQGKTYKFRVKAQNIVGLSLPDTTIPIECQEKLVPPYVELDVKLIEGLVVKA
GSTVRLPAIMRGVPVPTAKWVTDGNEIKTEGNYKIETDDYSTVLTIKECARKDTGEYLLT
VSNAAGSKTVSLHLTVLDVPGPPTGPINILEVTPEYMVISWRPPKDDGGSPVLNYIVEKQ
ESKKETWGVACSGIQHTKLKVPRLQKGCEYIFRVRAENKIGIGAPLDSIPTIAKHMFDPP
SPPGKPVVSDITENAATVSWTIPKSDGGSPITGYILERREISGKWVRVNKTPVLELKLRA
TGLFEGNTYEFRAFAENMVGISKPSPISDPIKISRPIRPPGPPINPKLKDKTRETADLVW
TKPLKDGGSPILGYVVECQKTGTTQWNRINKDELIPQCAFRVPGLIEGNEYRFRIKAANI
VGEGEPRELPETVLVKDILSPPEIDLDVTCRDLITVRVGQTIHITGRVKGRPDPDITWSK
DGKVLVQDKRVEMVREFPRIELQVKEATRDDHGKYIIAAKNSSGHAQAFALVNVLDRPGP
CQNLKISYVTKDSCIVTWENPIDNGGSEITNYIAEYRQPNQRGWSIVSSDISKRLVKANL
IENHEYFFRVCAENKVGPGPVTETKTPILAINPVDRPGPPENLHIAETGKTFVYLKWRRP
DYDGGSPNLSYHVERKLKDSDEWERVHKGSIKETHYMVDKCIENKIYQFRVQTKNEGGES
DWVKTSEVVVKEELQKPVLDLKLSGVLTVKAGDSIRLEAGLRGKPQPEVVWAKDKDATDL
TRSPRVTIETTSNASKFVLTKSKRSDGGKYVITATNPAGSFVAYATVNVLDKPGPVRNLK
ISDISSDRCTINWDPPEDDGGCEIQNYILEKCESKRMVWSTYSAVILTNYAHVTRLIEGN
EYIFRIRAENKMGTGPPTETKPIIAKTKYDRPGRPDPPDVTKVSKEEMTVVWNPPEYDGG
KSITGYILEKKEKRSLRWVPVTKSAIPERRKKVTDLIPVHEYQFRVKAENEIGLGEPSLP
SRPVMAKDPIEPPGPPTNLKVVDSTKNSITLGWGKPVYDGGAPIIGYVVEMRPKVESAAP
DAGWKQCSVAAQVIHTEFTVSSLDEKQLYEFRVCAQNQVGIGRPAELKEAVSPKEILESP
EIDLDASLRKLVTVRAGCPIRLFGIVRGRPAPKVTWRRVGIDNVVRKGQVDLVDTMAFLV
IPNSTRDDSGKYSLTVVNPAGEKAVFVNVRVLDTPGPVAEFSVSDVTKMSCQLSWVPPEN
DGGSPVTHYILEKREADRKTWSTVIADIKKTSFKVANLIPGNEYFFRVTAVNEYGSGVPT
DMPKPILASDPLSEPDPPRKLEVTEITKNSATLGWLPPLRDGGSKIDGYIISYKEEEQPE
DRWTQYSIVKDLNIVVVGLKEGKKYKFRVAARNAVGVSLPRETEGIFEIKEQLMPPKILM
PDHVNIKAGQKLRIEAHVYGKPQPNCKWMKGEQDVFLSSRLAVHKAEKSSVLIIKDVTRK
DSDYYTLKAENSSGIATQRIRVVVMDAPGPPQPPFDISDIDADACTLAWHMPLEDGGSNI
TNYVVEKCDVSRGDWITVVASVTKTSCRVGKLTPGQEYMFRVRAENRFGISEPLTSDKMV
AKFPFDVPSEPKNARVTKVNKDCIFVAWNKPDSDGGSPITGYLIERKERNSLLWVKANDT
LVRSTEYPCAGLIEGLEYTFRIYALNKAGASKPSKPTDFVSARSPVDPPGKPEVTDVTKS
TVSLVWTRPKHDGGSKIIGYFVEACKLPGDKWIRCNSIPHQIPLEEYTATDLEENAQYQF
RAIAKTAINISWPSEPSDPVTIQAENVPPRIDLDVSMKSLLTVKAGTNVCLEANVYGKPM
PTITWKKEGEVLKPAEGIKITTKRNLSTVELFSVNRKQTGDYTITAENASGSKSATIKLK
VLDKPGPPASVKITSMYADRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVTANVPI
TSCSVEKLIEGHEYQFRICAENKYGVGEPIFTEPTTAKNPYNVPGPCDPPVISNITKDFM
TVSWKPPADDGGAPVTGYILEKRETKAANWTKVNRKPVIERTVKATGLQEGTEYEYRVTA
LNKAGPGKPSGPSKAAYARDPQYPPGPPAFPKVVDTTRNSISLSWSKPAYDGGSPIIGYL
VEVKRADTDNWVRCNLPKNLQDTRYVVTGLSENTEYQFRIYAVNKIGYSDPSDVPDKHLA
KDILIPPEGDLDAELRKVLILRAGVTMRIYVPVRGRPPPKISWSKVNANIRDRKGLDIKS
TDFDTFLRCENVNKYDAGKYVLTLENSSGKKSYTMVVKVLDTPGPPINLTVKEASKDSAF
ISWEPPLIDGGSPVTNYIVEKRDAERKSWSTVSTECPKTSFRTTNLEEGKSYFFRVLAEN
EYGIGEPCETRDAVKASETPGPVVDLKALAITKSSCNLAWKKPFSDGGSRIIAYTVEVMT
ADDSWQEVMRSKNLQFSTKDLTEGKEYTFRVRAQNDAGYGTPSEITVVARDDVVAPDLDL
RALPDLCYLAKEGSSFRLKIPIKGKPAPTVTWKKGEDKVLTETGRVAFEATAVNTTLLVR
DCQKDDAGKYTITLKNSAGSKEGTISIKVVGKPGIPTGPVKFEEVTADAITLKWGPPKDD
GGSEIANYIIEKRDNINNKWVTCASAVQKTTFRVSRLHEGNEYTFRISAENKYGVGEGLK
SDPVVARHPFDVPDAPPPPKIVEVRHDSASLTWTDPKKTGGSPITGYHLEFKERNSLLWK
RANKTPLRMKDFRVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPIVALDPIDPPGKPEVI
NITRNSVTLIWTEPKYDGGHKLIGYIVEKRDLPSKSWTKANHVNVPDCAFTVTDLIEGGK
YEFRIRAKNTAGAISPPSESTGTIICKDEYEAPSIVIDPTLKEGLTVKAGDTITVSAISI
RGKPLPTSVWSKAGKDFKPSDLVHIEATPTSSTLSVKYAARKDSGEYTITANNPFGTKQE
HVHVKVLDVPGPPGPIEVSNVSAEKATLTWSPPAEDGGSPIKSYVLEKRETSRLLWTLIA
ENIETCRHVVSKLIQGNEYIFRVSAVNQYGKGEPVQSEPVKMVDRFGPPGPPGKPEVTNV
TKNSATVGWKRPVDDGGSEITGYYVERKEKKGLRWVRVTKKPVSDLRCKVTGLLEGNEYE
FRVSAENRAGVGPPSDASNPVLIKDVAYPPGPPSNPQVTDTTKTSASLSWGKPHYDGGLD
IIGYIVEHQKEGEKEWVKDTTGTALRITEFVVANLQPGAKYNFRITALNAVGAGEPAQIP
NIEIKDREMIPDFELDAELRRTLVVRAGLTIRIFVPIKGRPTPEVTWTKDDIPLKGRANI
ENTDSFTLLIMTECNRYDAGKYIMTLENAAGKKTGFVNVKVLDTPGPPINLKPREITKDS
ITLHWDMPLLDGGSRITNYIVEKREATRKAYSTVSTNCQKCSLRIPNLVEGCEYYFRVLA
ENEFGIGEPAETTDPVRASEAPSPPESLNIMDITKSTVSLAWPKPIHDGGSRITGYIIEA
QKKGSTQWTHITTVKTLDCVVKNLTENEEYTFQVMAVNSAGRSDPRESRPVVVKEQLMLP
EFDLRGIYQKLVIARAGDNIKIEIPVLGRPRPVVTWKKEDRLIKQTQRVNFENTATATIL
NINECTRNDSGRYPLSAKNIVGEVSDVITVQVHDIPGPPTGPIKFDEVSSDFVIFSWEPP
ENDGGVPISNYVVEMRQTDSTTWTELATTVIRTMFKATHLTTGVEYQFRVKAQNRYGTGP
AISSEPVIANYPFKLPGPPGTPQVIAVTKESMTITWNEPVTDGGSPIMGYHIERKERNSI
LWQTVSKALVVGNIFKSAGLTDGIAYEFRVIAENMAGKGKPSKPSDPMFALDPIDPPGKP
VPLNITRHAVTLKWTKPEYNGGFKITGYTVEKRDLPNGRWLKANFSNILETDFTVSGLTE
DAAYEFRVIARNAAGAVSQPSEPSDAITCRDDIEAPRIMVDAKYKDTLVLKAGDVFRLEA
DVAGRPPPTMTWTKNEKELEDTAKLEIKRADFSTVVINKDSTRRDGGAYILTASNPGGFA
KHIFNVKVLDRPGPPEGPLAVSEVTSEKCVLSWLPPLDDGGAKIDHYVVEKRETSRLAWT
NVASEVPVTKLKVTNLLQGNEYVFRVMAVNKYGVGEVLESEPVLAVNPYVPPDPPKTPDV
TAITKDSMIVCWGRPDSDGGSPITNYIVERRDRAGLRWVKCNKRVLTDLRYKVSGLTEGH
EYEYRIMAENAAGISEPSPTSQFYKACDTVFKPGPPGNPRVLDTSKSSITIAWNKPIYDG
GSEITGYMVEIALPEEDEWKIVTPSAGLKATSFTITDLKENQEYKIRIYAMNSEGIGEPA
LVPGSPKAEERMLPPEIELDAELRKVVNIRACCTLRLFVPIKGRPAPEVKWTREYGESLD
KATIESTSSYTLLTVGNVNRFDSGKYILTIENSSGSKSAFVNVRVLDTPGAPQDLKIKEV
SKSSVTLTWEPPLIDGGSKIKNYIVEKRESTRKAYSTDNANCHKTSWKLDNLQEGCNYYF
RVLAENEYGIGLPVETPESVKVSERPLPPGKITLLDVTRNSVSLSWEKPEHDGGSRILGY
IVEMQSKGSEKWTTCATVKVTEATISGLIQGEEYSFRVSAQNEKGISDPRQLGIPIVAKD
LLIPPAFKLLFTTFSVLAGEELKVDVPFVGRPKPTVLWHKDNVPLRQTTRVNEESSENST
LLTIKEACKDDVGSYLVKLTNSAGEATETLNIVVLDKPGPPTGPVKIDEVTADSITISWE
PPKYDGGSSINNYIVEKRDTSTTVWHIVSATVARTTIKACRLKTGSEYQFRIAAENRYGK
STYLTSDSVVAQYPFKLPGPPGTPFISARSKDSMVVHWHEPVNDGGSKITGYHLERKERN
SILWVKLNKTAIPDTKFKTTGLEEGLEYEFRVYAENIVGIGKASKASECYAAHDPCDPPG
RPEPIIVTRNSVALQWKKPEYDGGSKITGYIVEKKELPDGRWMKASFTNVIETQFTVTGL
VENQRYEFRIIARNAAGVFSEPSESSGAITAKDEVEPPRISMDPKYKETIIVNAGESFKI
DADVYGKPLPSIHWLKGDQELTNTAHLEIKSTDFATSLSVKEAIRVDSGQYVLLAKNVAG
EKTASVHVKVLDRPGPPEGPIDITGVGAEKCMLAWKPPLQDGGSNISHYIVERRETSRLV
WTVVDSNVQTLSCKVTKLLEGNEYVFRIMAVNKYGVGEPLESEPIIAKNPFVVPLPPNAP
EVSAITKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCNKRLVSELRYRVTGLIE
NHDYEYRVSAENAAGLSEPSLPSTYYKACDPIYKPGPPNNPKAIDVTRSSVFLSWGKPIY
DGGSEIQGYIVEKCDVSVGDWTICTPPTGIKKTNMEVENVLEKHEYKFRICAVNKAGVGE
HADVPGSIIVEDKLEAPDLDLDLDLRKIVNVRAGGSLRLFVPIRGRPTPEVKWGKMDGEI
REAAVIDITSSFTSLVLDNVSRFDSGKYTLTLENSSGTKSAFVSVRVLDTPSPPVNLKIK
EITKDSVSLSWEPPLLDGGAKIKNYIVEKREATRKAYAAVVTNCHKTSWKVDQLQEGCNY
YFRVTAENEFGIGLPAETIDPIKVAEVPQPPGKITVDDVTRNSVSLSWSKPEHDGGSKIL
QYIVEMQVKGSDKWSECARVKALEALVTNLTQGEEYLFRVIAVNEKGRSDPRSLAVPVVA
KDLVIEPDVRPAFHSYNVQVGQDLKIEIPISGRPKPTVTWTKDDQPLKQTTRVNISDLPN
LTVLNIKEANKEDSGMYGITVANVIGQKSASVEIITLDKPDPPRGPVKFDDISAESITLS
WNPPLYTGGCQITNYIVHKRDTTTTVWETVSAAVARTTLKVTKLKTGSEYQFRIFAENRY
GQSFALESEPVVAQYPYKEPGPPGTPFVTTVTKDSMVVQWHEPVNDGGSKVLGYHLERKE
RNSILWTKINKTIIQDTHYKTSNLEENIEYEFRVFAENIVGVGKASKVSECYVARDPCDP
PGCPEAIIVKRSSITLQWTKPEYDGGSKITGYIVEKRDLPDGRWMKASFTNIIETQFTVT
GLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKYKDTVVVNAGEVF
RLEADVHGKPLPTIKWFKGDKELEETARCEIKNTDFKALVIVKDAIRVDGGQYILQASNV
AGTKSVPVNVKVLDRPGPPGGPVQVTGITSEKCSLSWNPPLHDGGSDISHYIVEKRETSR
LAWTVVASDVVATMLKVTKLLESNEYIFRIMAVNKYGVGEPLESVPVLMKNPFVVPDPPK
ALEITNIAKDSMTVCWSRPDSDGGSEIIGYIVEKRDRAGIRWTKCNKRRITDLRLRVTGL
TEDHEYEFRVSAENAAGIGEPSQPSPYVKACDPVFKPGPPTNAHVVDTTKNSITLAWGKP
IYDGGSEIQGYIVELCKADEEEWTVATPQTGLRVTRFEIRKLVEHQEYKIRVCALNKVGV
GEAASVPGTVKPEDKLDAPELDIDSELRKGILVRAGGSARIHIPFRGRPAPEITWSREEG
EFTDRVQVEKGINYTTLSIDNCDRNDTGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLV
VKDVKKNYVVLSWELPANDGGAKIKNYVIDKRESTRKAYANVSAKCGKTSFKVENLTEGA
TYYFRVMAENEFGIGIPAETADAVKASEPPLPPGKISLTDVTHTSASLMWEKPEHDGGSR
ILGYIVEMQPKGIEKWSVVTETKVCNAVVSGLSSGQEYQFRVIAYNEKGKSDPRALAIPV
IAKDLTIEPSFKLMFNTYSVQAGEDLKIEVPFIGRPTPKITWTKDEEPLKQTTRLNVHDT
PTSTILHIKESNKDDFGKYTVTASNAAGTATEHLSIIVLEKPGPPRGPVRFDEVSANFVV
LSWDAPDYKGGCQIANYIVEKRDTTTTTWHMVSATVARTTIKVANLKTGSEYQFRICAEN
RYGKSSPLDSKPVVVQYPYKEPGAPGTPFVTSASKDHMIVQWNEPVNDGGSKVLGYHIER
KDKNSILWTKLNKALILDTKYKTDGLEEGLEYEFRVSAENIVGIGKVSKVSELYVARDPC
DPPGRPDPIIITRNYVTLNWKKPEYDGGSKITGYIVERKELPEGRWMKASFTNVLDTEFT
VTGLVENQRYEFRVIARNAAGCLSEPSESTGPITARDEIEAPGASLDPKYKDVIVVHAGE
TFILEADIHGKPVPDISWSKDGKELEETTARMEIKSTLQRTTLTVKDCIRIDGGHYSLNL
SNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWAPPLHDGGSGISHYIIEKRE
TSRLSWTLVASEVQALNHKVTKLLPGNEYIFRVMAVNKYGIGESLESEPVVACNPYKPPG
PPSVPEVSAITKESMIVTWGRPADDGGAEIEGYILEKRDKDGIRWTKCHKKRLTDLRLRV
TGLTDGHFYEFRVSAENAAGVGEPSEPSIFYRACDAIYPPGPPSNPKVTDTSRSSVSLAW
NKPIYDGGAPVKGYIVEVKEATVDEWITCTPPTGLQGKQFTVTKLKENNEYNFRICAINS
EGVGEPAVIPGTVIAADKIEPPEIELDADLRKVVTVRASGTLRLFVTIKGRPEPEVKWEK
AEGTISDRAQIEVTSSYTMLVIDNVNRFDSGRYNLTLENNSGKKSAFVNVRVLDSPSAPV
NLTIREVKRDSVTLAWEPPLIDGGAKITNYIIEKRESTRKAYATVTNNCTKNTFKIDQLQ
EGCIYYFRVLAANEYGVGLPAETAEPVKVSEPPYPPGKVTLVDVTCNTATITWEKPESDG
GSKITAYMVEMQTKGSEKWSTCTQVKTLEATITGLSKGEEYTFRVIAVNEKGKSDPRQLG
VPVVAKDIEIQPSAELLFNTFSVKAGDDLKIDVPIRGRPTPTASWRKDGQPLRETTRVNV
QTSKTSTLLAIKEASKEDVGNYELCISNSAGSTTFSITVIVLDRPGPPCDVHIDSVSADN
VTLSWKPPEYDGGCHISNYIVEKRETTTTTWDVVSAAVARTSIKAVRLTTGSEYQFRVCA
ENRYGRSTYTESPSVVAEYPFKPPGPPGTPQVVHATKTFMTVSWNEPVNDGGSKVLGYHL
ERKERSSILWTKVNKSLISDTQMKVTGLEEGLMYEYRVYAENIAGIGKCSKSCEPVAARD
PCDPPGQPEVTNITRTCVSLSWSKPEYDGGAKITGYIIERRELPDGRWLKCNFTNIQETF
FDVTGLTEDQRYEFHVIAKNAAGLCSEPSESTGPVTVKDDIDAPRIMMDVKFRDTVVVKA
GEVLKINADIAGRPSPVISWAKDGKEIEEKARVEIVSTDHSTAITVKDCIRRDSGQYVLT
LQNVAGTRSLAVNCKILDRPGPSAGPLEITGITAEKCHLSWGPPQENGGADIDYYIVEKR
ETSRIAWTLCEGELRTTSCKVTKLLRGNEYIFRVMGVNKYGVGEALESYAVKALDPFTVP
NPPKSLEITSVTKDSMTLCWARPDSDGGNEISGYIIERREKNSLRWIRVNKKPVYDLRVK
SLGLREGCEYEYRVYAENAAGLSLPSDTSPLIRAEDPVFIPSPPSKPKILDSTRSNITIG
WIKPLFDGGAPVTGYTVEYKKTDETDWSIAIQNLRGTEYTVIGLTSGSEYVFRVRSINKV
GASDPSDISEPQVAKEREEEPAFDIDSEMRKTLIVKAGESFTMTVPFRGKPVPNVMWSKP
ETDLRTRASIDSSDCCTSLTIEKATRNDSGKYTLTLQNVLSTATLTLVVKVLDTPGPPSN
IAIKDVTKESAVLSWDVPENDGGAVVKNYYIEKREASKKAWVTVTNNCHRLSYKVTSLQE
GAIYYFRVSGENEFGVGVPTETKEGVKITEKPSPPEKLGVTGVTKDSISLSWLKPEHDGG
SRILSYLIEALEKGQQKWVKCAVVKTTHHVVHGLKENVDYFFRVSAENQAGLSDPKEILL
PVTVREQLASPEIDMKGFPHNTVYIRAGSNLKVEIPISGKPLPKITLSRDGVPLKATMRF
NTETTPESIIINLKESMAGDAGRYDITAANSSGTTKSFINIVVLDRPGPPVGPVVVSDIT
EDSVTLKWQPPNNDGGSQVTNYIVLKRETSTAAWSEVSATVARSIIKIMKLTTGEEYQFR
IKAENRFGISDHIDSQCVTVKLPYTTPGQPSTPWVTNVTRESITVGWHEPVINGGSAVIG
YHLEMKDRNSILWQKANKTLIRTTHFKVTTISAGLIYEFRVYAENAAGIGKASHPSDPVL
AIDATEPPRNVRVTDISKTSVSLSWTKPSFDGGSKITGYIVEKRDLPNGRWTKGSFTNVI
ETQFTVSGLTQHSQYEFRVFSKNAVGSISNPSDVLGPITCLDTYGAPEIDMQPEYTEVVK
YKAGSAVKLKLGISGKPIPTIEWFKNDKEIQTSAQVSIENTTEFASILIKDATRFNSGNY
ELKLKNAMGSASAHIRVQILDKPGPPSGPIQFKTITAEKITIMWEPPVDDGGATVTHYIV
EKRETSRVVWSLISEKLEECVVTTTKLIKGNEYVFRVRGVNKFGIGEPLESEPAIAKNAF
VTPGPPSVPEVTMITKHSMTVVWNRPTVDGGSEISGYYLEKRDKKSLSWFKVVKETIRDT
RQKVTGLTENSEYHFRVCAVNAAGQGPFSETSDFYKAADPIDKPGPPVKLKVVDTTKTSV
TLGWTKPAYDGGSAITSYTVEKREGEQEEWTVVSARGEIRTTEYVVSHLQPAVNYYFRVS
AINCAGQGEPIEMTESVQAKDILEEPEIDLDVALRTSIVAKAGEDVQIMIPFKGRPPPTV
IWRKGEKNLGTDERYNIQNTESSTLLTISQVTRNDTGKYVLTIENGVGEPKSSFVNVKVL
DTPSACQKLQLKHVSRGTVTLAWEPPLINGGSEITNYVIEKRDATKRAWSTVTTKCSHTS
FKITNLSEKTAYFFRVLAENENGLGEPCETSEPVKPAEVPGPVKDLAMKDSTKTSVTLQW
SKPDFDGGSIISDYVIEKKIIEEKEWSHAGISKTCEFEVEKLKELSVMEFRVSAKNEKGL
SDAVTVGPITVKDFVITPEADLSDIPGGQITVRIGHNLHIELPYKGKPRPTMSWLKDSIP
LKESEQVRFKKTENKISLSIKNVKKENGGKYTLILDNTVCRKSFTITVITLGPPSKPKGP
IRLDEIKADSVIMSWDVPEDDGGGEITCYSIEKRETSQTNWKMVCSSVARTTFKVPNLVK
DTEYQFRVRAENRYGVSPPLISADVLAKHQFRPPGPPGKPVVYNVTADGMTISWDAPVYD
GGSEITGYHVEKKERNSILWQKVNVSPISGKEYRITGLIEGLDYQFRAYAENSAGLSPVS
EPSKFTLAVSPVDPPGTPDYIDITRETVTLKWTAPLHDGGSKIVAYSIEKRQGSDDRWLR
CNFTDISECQYTVTGLSPGDRYEFRVIARNAVGTISPPSQSSGYIMTRDECVPPTIEFSS
EHFEGLTVKAGESIRLKVFIRGRPVPQVTWFKNGKEIEKKLNIEITNAIGYSTIFVRDAI
RDHRGIYTVEAKNASGTKQADITIRVQDTPGKVGGPIRFTNVTGEKMSLWWEPPANDGCA
AITHYVIEKRETSRVAWALIEDNCEACSYTALKLIKGNEYQFRVSAVNKFGVGRPLESDP
IVAQIPYTVPDAPGTPEPTHVTGDSITVTWARPKSDGGNEINQYILERREKKSVRWVRVS
SKRPIAETRHRVTGLTEGNEYEFQVMAENAAGVGPPSAVSRLIKCREPVNPPSAPTIVKV
TDTSKTSVSLEWTKPVFDGGMEIIGYIIEMCKADLGEWHKVNAETCIATKYTVIDLEAGE
RYKFRVSAVNGAGKGESCEVPATIQATDRLSSPEIDIDANFKQTHIVRAGATIRLFIAFL
GRPVPTATWSKADSNLSQRANIHTTDSFSTLTVENCNRNDAGKYIFTVENNSGSKSIAFT
VKVLDTPGPPGPITFKDVTRGSITLMWDAPVLDGGARIHHYIVEKREATRRSWQVVSSKC
NRQIFKVTDLTEGVPFYYRVSAENEYGVGEPCELTEPVVATEEPAPPKRLDIIDTTKSSA
VLAWLKPDHDGGSRITGYLLEMKQKGSDYWVEAGQTKQLTFTVEGLLENNEYEFRVKAKN
DAGYSEPREAFSSVIIKEPQIEPTADLSGITRQLITCKAGGTFTIDIPISGRPAPKVTWK
LEEMRLKETDRVTIKTTKDRTTLTVKDSMRGDSGKYYLTLENTAGVKTFAVTVVVIGRPG
VITGPIEVSSISAESCVLSWKEPEDDGGTDITNYIVEKRESGTTAWQLINSSVKRTQIKV
THLTKYMEYAFRVSSENRFGVSKPVESASIVAEHPFVPPSPPTRPEVYSVSANAMAIRWE
EPYHDGGSKVTGYWIEKKERNTILWVKENNVPCFECNYKVTTLVEGLEYQFRVYALNAAG
VSKASEASRPIVAQNPVDPPGRPEVTDVTRSTVSLSWSPPLYDGGSKIIGYIVERKPYNE
AGDGRWLKCNYTIVSETCFTVTALSEGEEYEFRVLAKNAAGVISRGSESTGAVTCRDEYS
PPKAELDARLQGEIVTIRAGSDLVLDAAIGGKPEPKVFWSKGDKELDLCEKISLQYTSKR
AIAIIKYCDRSDSGKYTLTVKNASGTKQVSVLVKVLDSPGPCAGRINISRVTEEKCTLAW
NAPHEDGGAEITHYIVERRETSRLNWVIVEAECQTLSCVVTRLIKNNEYIFRVRAVNKYG
PGVPLETEAIVARNSFTIPLQPGAPEAVGIGKEHIIIQWLQPESDGGSEISNYLVDKREK
RSLRWTRVNRDYIVYDTRLKVTGLMEHSEYQFRVTAVNAAGNSEPSDASQSILCKEPSYT
PAPPSAPRVVDTTRHSISLAWTKPMYDGGADLLGYVLEMKEEGTEQWYRPHTTATLRNAE
FTVTALKTSQKYRFRVAATNVNGMSEFSESSAEIEPVERIEIPELELAEDLKKTVTIRAG
GSLRLMVFVSGRPPPIITWSKEGIDLANRGIIDTTESYTLLIVDKVNRYDAGKYVIEAEN
QSGKKSATVAVKVYDTPGPSAAVRVKEVSKDSVTITWEIPTIDGGAPVNNYIIEKREAAM
RAYKTVTTKCSKTFYRITGLIEGAMYYFRVLPENIYGIGEPCETSDAVLVSDVPMVPQKL
EVVDITKSTVSLAWEKPQHDGGSRLTGYVIEASKAGTEKWMKVVTLKPTVYEHTIISLNE
GEQYLFRVRAQNQKGVSEPREIVTAVIVHDQKVLPTIDLAGITQKTVYVPAGRPIELAIP
IGGRPTPAVSWFFAGSKLRESERTKIEIDAKVAKLSVRETTIHDTGEYTLELKNAAGTTA
DTIKVIILDKPGPPTGPIRTDDIDSTSVTISWEQPELDGGAALSGYVVEQRDAHRPGWLP
VSESVTRTMYKFTRLTEGSEYVFRVAATNRFGIGSYLQSEIIECKSKISLPGPPDTPQVI
DISREGMTLTWHPPEEDGDSQITGYIVERKEVRADRWVRVNKIPVTMTRYRSTGLIEGLE
YEHRVTAINARGTGKPSRPSKPVVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSAPEEEGG
SKVTGYLIEMQKVDQFEWTKCNTTPTKIHEYTLTHLPQGAEYRFRVMACNAGGPGEPADV
PGTVKVTEMLEYPDCELDEKYREGLFVRQGGVIRLTVPIKGKPIPICKWTKEGHDISKRA
MIATSDTHTELVIKDAEREDSGTFDLVLENKCAKKVVYIQVRVIGIPNPPEGPLEYDDIQ
ARSVRVSWRPPTDDGGADIIGYIIERREVPKTAWYTVDSRVRGTSLVVKGLKENVEYHFR
VSAENQFGISRSIKSEEPVVPKTPLNPPEPPSNPPEVHDVTKSSVSLFWSRPKDDGGSRV
TGYYVERKETSTEKWVRHNKTQITTTMFTVTGLVPDAEYQFRIIAQNDIGESEPSPASEP
VVCKDPFDKPSQPGEIEITSISKDSITLEWERPECDGGKEILGYWIEYRQSGESAWKKCN
KERIKDRQFTMGGLLEATEYEFRVFAENETGVSRPRRTAMTVKTKLTSGETPGIRQAMTD
VTTNLGEAAQLTCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVLTEEQDDEG
VYTCMATNDVGEIETSGKLLLQAPPQFHPGFPLKEKYYAGVGGTLRLHIVYIGRPVPAIT
WFHDKKPLRDSENVTIENTEHYTHLVIKNVHHKTHAGKYKVQLSNIFGTVDTVLNVEIQD
KPDKPTGPIVVEALLKNSVVISWKSPQDDGGALITNYVVEKREAKEGTEWQLVSSSISGT
TCRIVNLTENAGYYFRVSAQNTYGISEALEVSSVVVIKSPFEKPGQPSQPVATAVTKDSC
VVSWKPPASDGGAKIRNYYLEKREKKQNKWIAVTTEEIHETVYSVTSLVEGLEYEFRVKC
ENLGGESEWSEVSQPIIPKSDVPIQAPHFKEELRSLNVKFRATATFVCKVTGHPKPIVKW
FKQGKEILPDGEKVKIQEFKGGYHQLVITNAMDDDATIYQVRATNQGGSVSGTASLDVEV
PAKIHLPKNLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRS
FTSLVFPNGVDRKDAGFYIVCAKNRFGIDQKTVELDVADVPDPPRGLKVSDISRDSVNLS
WNAPATDGGSRITNYIIEKCATTAERWIRVAQARDTRYTVVNLFGKTSYQFHVIAENKFG
QSQPSEPTEPIVTKEDKTRMLNYDEEVDETREITTVKASHSSTKELYDKYMIAEELGRGH
FGIVHRCVETVSKKTFLAKFVKVKGADQVLVKKEISILNIARHRNILYLHESFESLEELV
MIFEFISGADILERISTASFELSEREIVNYVRQVCGALEFLHNHNIGHFDIRPENIIYIT
RRSSIIKIIEFGQARQLKPGDSFRLQFTSPEYYGPEVHQNDVVSTATDMWSLGALVYILL
SGINPFIAETNQQTIENIMSAEYNFDDEAFKDISIEAMDFVDRLLVKERKGRMTATEALS
HSWLKQRTEKISTKVIKTLRHRRYYQTLVKKEWNMVVSVARISCGGAVRSQKGVTVAKVK
VASIDIGPISGQIMHAVAEEGGHAKYICKIENYDQSTQVTWYFGTRQLENNGKYEISYHE
GVATMYVKDITKADDGTYRCKVVNDYGEDSSYAELFVTGMREVSEYYRCRTVKKVKRRID
TMRLLERPPEFTLPLYNHTAYIGENVRFGVTITVHPEPRVTWFKSGQKIKPGDDDRKYTF
ESDKGLYQLTIHNLTEDDDAEYTVLARNKYGEDSCKAKLTVIPHPPPADTTLRPMFKRLL
ANAECQEGHSVCFEIRVSGIPKPKLKWEKDGQPLSCGPNIEVVHEGLDYYALHIRDTLPE
DSGYYRVTATNSAGSASCQAYLKVERLTYVKHEYKTEEEREKHVRKQIDKTLRMAEILSG
TETVPLTQAAQEALREAAILYKPAVSTKTVKGEYEIQKKEIKEERRLRMPYQIPEPRRHV
RTTLEEDQSIKQFVPMSDMKWYKKLRDQYEMPGKLDRIVQKRSKRIRLSRWEQFYVMPLP
RISDQYKPKWRIPKLSQDDLETVRPARRRTPSPDYELYYRPRRRSLSDLSDEELLLPTAD
YLAMKRIEEERLRLEEELELGFSASPPSRSPPRFELSALRYSSIGEQASTEEARKRELRY
STYHIPTKTETGASYAELRQRHDRAAYRPPKQKQRIMDEREDEELLRPVITTQRLSEYKS
ELERMAQEEESRMRRRQREITEITSEEEAEIKMVERVQREFSPPSRLLRRRRSLSPTYIE
LMRPVSELIHPRSRPVEETERRSPTPERTRPRSPSPVTSERSLSRFERMARFDIFSRYDA
MKSALKTQKTMERKYEVLTQQPFTLDHTPRITLRMRSHRVPCNHNTRFILNVQSKPTAEV
KWYHNGIEIQESSKIHFTNTSGVLTLEILDCHIDDSGTYRVVCTNYKGECSDYATLDVTG
GDYTTYSSRRRDEEVPRSIFPDLTKTEAYAVSSFKKTSAIEAISSVREVKSEMTETRESL
SSYEHHASAEKKITAAEEKSFEERASHKKFKTTLPATILTKPRSITVYEGETARFSCDVD
GEPTPTVTWLRAGQAIVSSRRFQVTRTQYKSTFEISSVQTLDEGSYSLVVENSEGRQEAH
FTLTVQRAKIPEKAILSSPRVKSPEPRVKSPEPVKSPKRVKSPEPPIAHPKAKSAAEGRT
APTEKVQLPAATPPKITQQLKVEACGDKVKFSCAVESSILSVREVAWYKDGNKLKEDSHF
MFHYSADGTYELKIHNLKESDQGEYTCEIIGEGGISKTNFQFVGQVFKSIHSQMSSMTEK
SKSAEKEAEALKVSTQKKSAVTAQEKAVIQEEIVKKSVISEEAKRSHAEIKASSTKMAVS
EGQKFTVKANIDGASEVKWVLNGMELPNSEAYRYGVSGSDHTLTIKKASHKDEGILTCEG
KTDEGIVRCQYDITFTTELSNAPAFITQPKSQNVNEGQDVLLTCEISGDPSPEIEWFKNN
QPIAISSKISVNRSNTIYSLNILNAAVSDSGKYTVKAKNYHGQCSATASLTVLPLIEEPP
KEVVLRTSGDASMQESFSSQSLQMSASKQEASFSSSSMTETKFASMSAQSMSSSMKESFV
EMSSSSIMGKSSLTQLESSTSSMIKSSLRGVSPKIEALPSDISIDEGKVLTVSCAFSGEP
APEVTWSCKGRKITNQEQQGRFHIETSEDLTTLIIMDVQKNDGGLYTLNLGNEFGTDSAT
VNINIRSI
NT seq 113427 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaaaagcgccaacatttacgcagccgttaaaaagtgttgtggcactggagggt
agtgccgcaacctttgaggctcatattagtggttccccagttcctgaggtgagctggttt
cgggatggccaggtaatctctgctgcaactctgcccggcgtgcagatctcctttagcgat
ggccgcgctaaactcatgatccccgccgtgacagcagccaacagtggaagatacagctta
caagccaccaacagatctgggcaagccagtagtaccgttgagctacttgtcacagctgaa
acagcaccaccaaactttacacaacgtctacagagcataacagtaaggcaaggaaagcaa
gttcgacttgatgtaaaagtgactggaatccctacacctgtggtgaagttttatcgggat
ggagcagaaattcaaagctccctcgattttcaaatttcacaagaaggagacctctatagt
ttaataattgcagaagcttatcctgaagactccggaacctattcagtaaatgccacaaat
agcgtgggacgagctacttcaacagccgaattgctggttcaaggcgaggaagaagcagta
cccgctaaaaagacaaagacaattgtttcgactgctcagatttcgcaaacaagacaagcc
agaattgaaaagaaaatagaaacccactttgatgctagatcacttacaactgttgaaatg
tccatagacagtaccacagggcaacagctcccacacaaagcacctccacgaatgcctcct
agacctacatcaaaatcgccaactccaccaatcagtgcggcgaaagtacaaatggcacga
cagcaatcaccatctcccattagacagtcaccatcacctgtaagacatgttagagcacca
acaccatcaccagtcaggtcagtatctcctgctggaagattctccacttcacctattagg
cctgtgaaatctccattactgacccgtaaagcacaggcgacagttgcaactgctgctgac
gttcttcctccttggaagcaagaaagttttgtctctgcatcagaagcacggatgcaggaa
actagagtaactacaagtgctacccagataaggacagaagaaagatgggaagggagatat
ggtgttcaagaccaggtgaccattagtggtgcggctgctggtgtcgctgttgctggtgta
gctgctggtgctaaagaggacattgataaaacagcagctgttgctactgtacttgctgca
gttgacctggctagagtgagagaaccagttccaagccctgtagagcaggttgctaaaagg
acagcaatgactgcggtacacattcaacctggtcaggagcagataagaaagcaagctatg
atagtagttgctactgataaatccaaagaacaggaaataatatcaagaactagagaagga
attgctaccaaacaagaagtacacatcactcgtgaaaagataagaaaggaaccagagaaa
acacctatacccaaggtaataattgctgttgacaaaaccaaagaacaagaaaaaatatca
agagctagagaagaaatttctacaaaaggagagcaaattcacatcactcatgaaaagata
agaaaggaagctgtgaaaccttctgtgcctaaagtagttattaccactgaaaaacctaaa
gaacaagtcataatatcaagaaccagagaagaaattgctaccaaacaagaacgggtacaa
gtaactgatgaaaagataagaaaggaagctgaaaaaacgactataattccggcagtaatt
gccactgataaattcaaagaaccagtcacaataccaagagctagagaaggaattactacc
aaacaagaacaaattcatctagctcgtgatcagattggaccttacaaaaaagctgaagct
gtagctacagttgttgctgcagttgatcaggcacgcgtcagagagccctgggaggtagag
tatgctgaagaaggctatgctgagcagacagctttgggatatgaatataaagagcgtaca
actgcaggtcacattgttgaggtgccagcagaacatcatgttgtcaccaaaccagtgcac
gtgccttctgaaacaaaagtttccaccgctgaaaaaatgggaatgcatatatcaacacag
attaaaagaacagaagaagccagaaccgaaaaagcagtccttgtggaacacacacgtccc
cggactgcaagtcctcattttacagtttcaaaaattactgttccgaaaccagatcatact
tacgaggtttcaatagcaggctctgctatggctactctagaaaaagagttatcagcaact
tctgttcaaaagatcaccagatctgtgaaatcacctcaagtaaagccacatgaaaccaga
atgatgacagagaaagttgtctcgccacaatttccctttggagaggcagctgatgcctat
aagagtcgttatgatgttgagaccaaaagagacataagtgtgagcattaccggtggtgtg
gtacgggaggagcatattgaattaatgcaagaaggtgaaaccaaggtgacagaaacggct
agagttcctgagccagcagaagtccctgctgccccgccaaccttagtctcaggtctgaaa
aacatgactgttatagaaggagaatctgtcactttggagtgttacatctctggccatcca
gccccgactgtgtcatggtacagagaagactatcagattgagagttcaatagacttccag
attaccttcaaagcaggagttgctcgccttgtgattcgtgaagcctttgcagaagacagt
ggaagatttacttgcacagcttccaattcagctggaactataagcacttcatgctacttg
catgtgcaagtgtctgaggagattgaaagccgagaaacagtttctgcaaaggctgtcaca
gaagagaaacgctatgtggagtcaaaagatgtggtaatggttgataccactgttacagaa
caagaaatgtttggagaagctgcggctccttattttttaaccaaacctgtagttcagaag
ttagttgaaggtggaagtgtcatttttgagtgccaaattggaggcaacccaaagccacac
atctactggaaaaaagctggggtacctctttctactggatacagacacaaagtgagttac
aaaaaagagactggggaatgcagacttgaaatttctatgacctttgccgatgatgccgga
gaatacactattgttattcgcaataagcatggagaagcttctgcatcagcctctttactg
gaagaagctgattatgaggtctacctaaaattgcaacaagaaatgatgtaccaaactcag
gtgactgcatatgtacaagaaccaaaagtggctgagatagccccagctatttcatatgct
gactatgaaaaagaatatgaaaaagaacaagctcttattaggaagaaaatggcaaaagac
actgtacagatccggacttatgtagatgaacaggaatttcacatttcttcctttgaagaa
agacttatcaaagaaattgaatacagaattattaagaccaccctagaagaactcctggag
gaagacagagaagagatggtggttgatgttcctgaatctgaaacagttgaggcaggattt
gatttaggattaaagaattatagaatctttgagggaatggctgttactttccattgtaag
atgtctggatatccattacccaagattgcatggtataaggatggcaaacgcattaagcat
ggagagcgctaccacatggaggttctgcaagatggcagagctagtctcaatttacctgtt
gttttgcctgaagatgaaggaatttatacagtctttgccagtaatgttaaaggaaatgcc
atttgctctgcaaagctatacattgaacccgttgcgcctgttggagctccaggttatatg
ccagcaccagatgttatgaaaagatacaggtctctttctccccgttcaccaagccgttct
ccagcccgtagttctccatctcgttctcctgctcgcagactagaggaaactgatgaggga
caactggagagattgtataagccagtttttgtgttgaagcctagttcctttaaatgtgca
gaggggcagacagcgagatttgacctaaaagtagtgggacgacccatgcccgaaacatac
tggtttcataatggtcaacaagtggttaatgactttacccataaaatagtagttaaagaa
gatggcacacagtcaatgatcattgtcaatactaggcctgatgattcaggtgaatggact
gttgttgctcaaaacagggcaggcaaagctacgatctcaatgaccttgacagtggaagct
caagaacatctagtgaaaccacattttgtagaaaggctgaagaacgtcagtgtcaaggaa
ggtgctaaactgaaaatggcagtgaaagctactggtaaccctaatcctgatattgtatgg
ttgaagaacagtgatatcattgtacctcataaatacccaaagatcaaaattgagggaact
aaaggagaagctgcacttaaaattgagtccactgtcaagcatgatgctgcatggtatact
gccactgctatcaataaagcaggccgcgacactacacggtgcaaggtgaatgtcgaagtg
gaatttgcagaaccggaaccagaaaggaaactcatcattccaagaggaacgtacaaagca
aaggagattgcagctcctgagctcgagcctctccatttgcgttatggtcaagagcaatgg
gaggagggagacctttatgacaaagaaaaacaacaaaagccattctttaagaagaaactc
acttcattaaggctcaagtgctttggaccagctcattttgactgcagactgacaccaatt
ggtgaccccactatggtggttgaatggctacatgacggcaaacccctagaggcagccaat
agacttcgcatgattaatgaatttggatactgcagtctggattacggagtagcctatcct
agagacagtggagtgatcacttgcagggcaagtaacaaatatggtgctgaccacacatca
gctactcttattgttaaagatgagaaaagccttgtggaagaaactcagttgccagaaggc
aggaagggactacaacgaattgaagagatggaaagaatggctcatgagggagcccttgct
ggagtgacagaggatcaaaaagagaagcaaaagccagaaattgttttggtccctgagcct
gcacgagttctggaaggtgaaactgcacggttccgctgccgagtcaccggctatccacaa
cccaaagtcaattggtatctcaacgggcagcttattcgtaaaagcaaaaggtttagactt
cgctatgatggtatctattacctggacattgtggactgcaaatcttacgatacaggtgaa
gtgaaggttactgccgaaaatccagagggggtaacagaacataaagtaaaacttgagatc
cagcagagggaagatttcaggtctgtccttcgccgggcacccgaaccgaggcatgagcca
gcagcagcagaacctggtaaactcctctttcaagtacaaaaagtagacaagcctgctgag
acaactaccaaagaggtggtaaagctaaaaagggctgagagaatcactcatgagaagcta
ccagaggagactgaagagctacgcagtaaattcaagcgtaggacagaggagggctattat
gaagctattactgctgtggagcttaagtctcgtaaaaaggatgaagcatatgaagaaatg
cttaaaaagacaaaagaggaacttcttcactggaccaaagaattaactgaggaagagaag
aaagcacttcttgctgcaggtgaattcacggttccagctgtcaaaccagacaagcttggg
cttagtccaagcatggaggctcctaagatacttgaaagaatccaaagccagacagtagct
caaggtagcgatgcacatttccgtgttagagtagtagggaagccggaccctgaatgtcag
tggttcagaaatggtgtacaaattgagaggtctgatcggatatattggtattggcctgaa
gataatgtttgtgaattggtcatcagagatttaacagctgaagactctgccagcatcatg
gtgaaagctatcaatatagtgggtgaaacttcaagccacgctttcttgctagtacaagcc
aaacagttgataaatttcacgcaaagtttacaagatgttgttgctaaagagagagattcc
atggcaacctttgaatgtgaaacctcagaaccctttgtcaaagtgaaatggtataaaaat
ggaatagaaattttttctggagacaaatacaggatgcactctgacagaaaaggtcacttt
ctttctgtgctaatgattgacgtgtcggatgctgaggactacagctgtacattggtagaa
gatgaaactgtaaaaacaactgctaagcttattgttgaaggtgccattattgagtttgtt
aaagaacttgaggatattgaagttccagagtccttctcaggtgaacttgaatgtgagatt
tcccctgaagacgtggaggggaaatggtattgtggcgatgtggagctcacatccaatagt
aaatatgtgattacgtcccgacgtggtcgtcaaattctaactgtcaaagatgttagtaag
gaagaccaaggagagtacagctttgttgtagatgacaaaaagacaagctgcaaactcaag
atgaagccccgtcctgtcactattctgcaaggacttactgatcagaaagtctgtgagggt
gatattgtgcaacttgaagttaaagtctctctagaaaatgttgaaggtgtctggatgaag
gatggtattgaaattcagccaaatgaccgtgtgcatgttgtgctggacaagcaatcacat
atgttgttagttgaagatgtaacaaaggaagatagtggaaactactcttttaatgttccc
agtcttcttctctcaaccactggacgagtttctgtttatagtgtggacatagtagtacct
ctaaaagatgttcacagtattgaaggaacaaaagctgtctttgaatgtaaagtttcggtg
cctgatgtgtcttcatccaaatggtacctaaacgatcaacaaataagtcctgatgaccgt
atacaagctgtctgcaaaggcactaaacagaggctagtgcttgtcaggacccatgcttca
gatgaaggacactataaactgatggttggcaaagttgaaactagttgcaacctcatagtt
gaaaaaattcagattattagaggccttcatgacatcacatgcactgaaactcagaatgta
tcctttgaggttgagctatctcatgcaaatatcgatgttttatggcacttcaaagatcaa
gagctcaacgctagtcttaagtacaaaattgaagcacgtggcaaaatatataaactgaca
gtggtgaacatgatgaaagatgatgaaggtgaatacacattttgtgctggagaaaagaaa
acatctgggaaacttgttgtagcaggaggtgccattgcaaaacccctcactgatctaaca
gtggctgaatcccaagaagccatttttgaatgcgaggtggcaaatcctgattctgaaggc
cagtggttgaaggacggtaaaccattatctatgacagatcgcttccaaagcgaatcagat
ggtttaaagaggattcttaatattccagtcaccacccttgatgatatgggtgaatatacc
tacaaagtggcatcctcaaaaacatctgccaaactgaaggttgaagctgttaaaataaag
aagacgctaaagaacttgactgtaacagaaacacaagatgcacttttttctgtggaactt
acccatcctgatgttaaaggagttcagtggatcaaaaatggcattgaacttaaatcagat
gacaaatatgagattacagtaaaggaaaatgtttacacactgaaagtgaaaaattgtgtt
atcacggatgagtctgtttacagttttaagcttggaaggttaggcgccaatgccagactc
catattgaaactgttaaaataatcaaaaagccaaaagatgtgactgctttggaaaatgcc
actgtttcctttgaattgagtgtgtcccatgataccgtaccggtcaaatggttccacaaa
aacgttgagattaaatcaagtgacaagtacaggatgatctctcaaaggaaagctcacaag
ctgatgttgcagaatatatctccctctgatgctggagaatacacagctgtagtagggcaa
ctggagtgcaaagcaaagctctttgtggaaactgtacatattactaagaccatgaaaaat
attgaggttcctgagaccaaaacggcctcctttcagtgtgaagtatctcatttcaatgta
cctgcagtatggctaaaaaatggagtggaaattgaaatgagtcaaaagttcaaaatagtg
gttcaggggaaactccatcagcttaatatcatgaacacaagtagtgaagattctgcagaa
tatacatttgtctgtgggaacgacagagttagtgcaactctgacagtgaatcctatcctg
attacatctatgctgaaagacatcaatgctgaagagaaagatacaataacatttgaaata
actgtcaactatgaaggcatcacatataaatggttaaagaatggggtggagataaaatca
accgacaggtgccagataagaactaaaaaacttacacattctcttgccataaggaatgtc
cactttggtgatgctgcagaatacagttttgttgctgggaatgctgtttcatcagccact
ttatatgtggaagctcgtcacattgaatttaggaagcacattaaagacattaaggttgta
gagaagaaacgagccatttttgaatgtgaaatctcagaacctgacatttcagtgcaatgg
atgaaagatggccaggaactccaacttggagacagagtgaaagttcagagggagagattt
gtccatcgcctcctcattccttccacgaagatgtctgatgctggacagtatactgtagta
gccggaggaaacatgtccagtgctaccttagttgtggaaggtcgtgatattcgtatcagg
agcgtccgtaaagatgttcaggtcattgaaagacaacgtgctgtaattgaatttgaagtt
aacgaagatgatattgaagctcgctggtataaggatggcattgagatcaatttccagatt
gaggaaagatatcactatgttgtggaaagaagaatccaccagatgagcatcactgaaaca
agatacagtgatgctggggaatatacctttgtagcaggaagaaacagaagctctattatt
ctctatgttaacgctccggagccaccccagattattcaggagcttcagcccaccactgtg
gaatccggtaaaccagcccgtttttgtgctgtaatatcaggtagaccacagcccaaaatt
tcctggtataaagatgagcagcagctttctccaggctttaaatgcaagtttcttcatgac
gcacaagaatacactctattgttgattgagactttccctgaagatgcagcagtttacacg
tgtgaagcaaagaatgactatggcgttgccactacttcagcttcactttcagtagaagtc
cctgaagttgtttctcctgatctggaagtgccagtttatccacctactcttataacaccg
cttcgagatgttgttacttctgagggacagtctgcatgttttcagtgcagaattacaggg
acagatctgaaaatctcttggtattgcaaagataaagagatcaagccatcccgtttcttt
agaatgactcattttgaagacacttgccagctggagattgcagaagcctatccagaagat
gaaggaatttatacttttgttgctagtaattctgtaggccaagtgacaagtactgctaac
ttgaagttggaagctccggaaaaagttcttcaggagaaaatagaacaacaaattgaaatg
gaagtgaaagacttttctagttctgttgttgtgtctgctgaggaagaaggaacccaacgt
tacagcagcggcctgcaattgtctgatagaaataaaacacttgaatgtatgcctgaaaaa
tcagtttactccagcaaattagagatgaaaacagaggagggcagtgtcccagttttcctc
aaacaggtttctaatgctgaaataagtttaggagatgtagctaaactctcagttactgtt
attggcagtccaaaacctaaaattcagtgggtctttaatggagtaaagttaacctcttcc
atggattacaaatttgtatttgatggtaatgattatagccttatcattctggatacaaaa
tctgaagatgagggtgagtacatgtgcattgccagtaacaagtatggagaaactgcatgc
agtgcctatctaaaggtgaaggcaaaaatgactggaggagtctacaaaaaatcggccgtt
gtgctagagatggagaaacccccggaaaagaaagtaagtcctcaccgcccttgctttgtt
aagaaactggaacctgcgcagtgtgctcaaggtctacctgttgtatttgagtacgcagtg
cttggcgaacctggccccgaggtgcagtggtttaagggagatcagcagattaattctaat
gactactacactgtggttcacaatcccgacggctcgggttcactaactgtcaataaatgt
cagagtgatgacggcgggttatacacctgtaaagccacaaaccccctcggccaagccacg
tgctctgcagagctgctcgtgcccctgggcacagccagcgggaaggaacagcacggtggg
aaaccgctggcgaaatcctccgaggagccggcaggagagcagacggaagagtccagtttc
tggcggcaggagcaggaagcgttgtgcaccgtcgggccaaaggacaggcagccggtgcag
agcggagaggcggccccgctgcttgaggtttctccctccgccgccagcctgcagcaggag
acgactcttccctggcacgcggcgctactccaggccccgcgggctgaagggtgcctggac
gtttcccctcacactgcagagccggcggcttcaaccccaaagccgcttccacccgcagcc
tttaccacgagcgaggtgcggaagcccctgagcctgctggagccgcgtcttgagccaatt
caaagtccgccagtggctgagctgcccgcccctcagcggcacgggacgcccgcgctctgt
gtgccggtagtgcaagagaacagcccgcaggacaaggagccagacctacatcctggagct
gccgaaggaaacgtgcttggcgctcccgggacccgcgcgccaggcggcgctgctgcggct
ggagggggaggagggcagccagtgggtgaggctcatgccacggagctagacgccctggag
gtacctgcggaggcaaacccagtccaggaactgcccgcgcccttgcacaggcctctaacc
gactcccaaaagctgtgtgcaaaagagggctcctggtctgccccggcagcagctcagtac
aacggggctttggcgcaggagcggatggtacacgctgctctcctcacggaggaaaagtgg
cagctcacgggggaacatgcgcaccaagtgcccggactagacaagctagtggctgcagaa
gcccaaagggaaggagcgaggctgctgaatttgccggtggtaggtgggcaaaccacactc
cccaaggaagaaccttgtagttttgtggagctgcccgaagatcacgcagccgctaggaga
agccctacgatgctgcacgccttagtctgggaagaacggaatgccctctgcggtgaaaag
tctggtcagtttcctgccctggacggggcgatgagcgttcagcctgtcaaagagctccct
tccgccctccacctccacacaactcattcagagcacgtgttgcctaaggaagacatcctg
gcttttcaaaaacctgtctcccatgtggctttccagagagaagaaaaaatgtgtaatcgg
gcagccacggcagaggagaagagagaattatctgcggaacaactggacggttttcggagc
agtccggaaggaatacagcccacagctctagtggaacctcaaatacagaactgccttgcc
actgtggctgaggatatccctgtgccaaaagaacaaatcattagtgcgacagaaaaggag
cagaaagctgccctgagaaaagaagactctcaaacagttatgcagctatcaagcgtgatg
gagagcagggctttagcagaccagagtctcgatgaaacatttgaggagaatcagacagtg
agcggtgaggtgaaatcggaacccagattcctttcggaatccgtttgcaccgaggaaaga
agtgttccactggagagtgcaaatgtgttagaagccgcacaacatgattttgctgcaaga
atacaagaaggtcaatcagtgaggcttccattaatactagaagaaaagcagcctctccaa
gaagaacatgcagtcgaactacagaggtcagaaactggaaccataaaggcagagaagcaa
ccaaaggagacactgagagcacatgaaatagaagacagagaagtcctgtccaaagaaaac
cagtttgttgttcaagttcctaagagttgtagcttagacataaagactcagatcagaagt
gccctgaaagctgcaatcacaagtgaacaacttctcttgtcttccgaatggctgagtgat
ataaaaaatattgaagtaacaagagtgaaagtcaacaaagaacctaaatacacaatgtgc
acctgccttataaccattggaagttccagtgccatagagataacattctttctagaagaa
atataccctcagacagttggcttgaagactgaactcaaggctgctttgtattcgattatt
tacgaagaaaaacatattttgatggcagaacaaccccgaactatgtcagtaactatgcct
cagaagttgtttattactcatgcaccttttgcagaaatctcatctgctgccatagcttca
gatcagagatgtcggtgcaaacacagtcactgcagaccttgctttggcagctgtgccact
ggagaaatcagtggagacactgaccgtgaaacagatgaagtgctggagctgcagcagggg
gaaataaccttagaatctgaggcaccactgggacagcttttgtccgcacgagcagtcagc
atggttgctgttgaaagtcagatcagagatgtcggtgcaaacacagtcactgcagacctt
gctttggcagctgtgccactggagaaatcagtggagacactgaccgtgaaacagaaaaaa
gaagaaatatctgaggacgatggtggagaggttctcttaactcaggcagggacaccagag
ggcaaactagttagaaaagattatcctgtcattcacagaaatcttgtagacactattgtc
gaggaaggcgatagcttaagtctggtatcagtaataacaaatgtccaaaaggtgaattgg
tattttgagggtaaactggtgtcttcaggcaaacagttcaagtgttcacaagatcatgac
acatacacactagtaatcaacaaagtacacaaggaagtgcaccatggagagtatgcctgt
gaggcactgaatgaaggtggaaaaacaacaacatcagcgaaaatcacagttgtaaaaaga
gttgcgcccatactgaggaggagaatcgagtcgcaggaagtagccgttaaccatcttgct
aaatttacctgtgagattgagactgctcctaatgtcaaattccagtggtacagagctggc
cgagaaatatatgacagtgacaagtattccatacgtactgctaaatatgtgtccacgctg
gaaattccaagacctcaggtagttgactgtggagaatacagctgcaaagcttccaaccaa
tatggcagcgtaagctccactgctattttaactgtgactgaagcattccctccaaccttt
ctaacccgacccgaatctatcactacttttgtgggtaaaagtgcgaggttcctgtgcaca
gtgtcaggcacaccggtgatcgacacagtgtggcagagagacggctctgccatctcttct
tcagagcaccacaagatttcagcagttgataataagcatattttagagattaaacatgtc
acagtaaacgacagaggaatttacacctgcaaagcctcaaacaagtttggcgctgacatc
tgccagggggaaatgataattattgataagccacatttcattaaggaattacagtcggtg
cagtccgctgtcaataagaagatacgtttggagtgccaagtagatgaagataggaaagtg
tcagtagtgtggaataaagatgggaacaaaatacccccaggcaaagattacaaaatttat
tttgaagacaaaatagcatcgcttgaaattcctttggccaaacttaaagattcaggaaac
tatgtatgcactgcttcaaatgaggctggaagtagctcctcttctgcaactgtcacaatc
agagaaccaccatcttttctgaagaaggtggatccatcttatttattgacgccgggcgag
tcagcgcatcttcagtgcaaaatcaaagggtctcctgaaatccaagtttcttggttcaag
aataacaaagaaattagagagagtaacacctacaaaatgtcatttgccaactctgtagct
gggcttgtcatttccgacgtgagagttgaagatagtggaagttactcttgtgaagcagtt
aacgatgctggcagtgatagctgcagcactgaaatagttgtcaaagaacctccttctttc
atcaaaacacttgaaccggcagagatagtgaaaggaacaaacgctacacttcagtgtgag
gttgctggtactggaccattcgagattagctggtttaaagacaagaagcagattcgcagt
agtaaaaaatatagagtgatgtctcagaaatctcttgttttcctggagatttcttcattt
aatagtgcagatgttggtgaatatgagtgtgttgtagctaacgaagttggtaaatgcttc
tgcagtgcaacattcatactgaaagaaccaccatcttttattaagaaagttgaaaatgtt
actgcacttgtgggagacacaattaccttacagtccgttgtgaaagggtctgctactatt
actgtaacgtggatgaaaggaaaagacattattaaagaagataacaaagtcaaagtgacc
tttgaaaatggtcttgcaacgctgcagatcacgggtgtcgatattagttctggtggcaag
tatacctgtgtagctgagaatgatgcaggaagtcaaacctgttttggagaattagcggtg
aaagaacccgcccaaattactgagaagcctgagttgattcaggtgactgcaggagacccg
gccgttctggagtatactgtcgcaggcacgccagagttaaaaaccaaatggttcaaagat
ggcaaaccgctgccttccagcaaaaagtatagaattagttttaaaaataacgttgcccag
ctcaagttttataccgccgaaatacaggacagcggcgaatacacattcgagattgcgaac
gatgttggaggcagttcgtgcaccaccaccttcactgtgttagaccgaaccattgctccg
ttctttgttaagccgctgaggaacgttgacagcgtagttagcgcctcctgccgcatggac
tgcaaaatctctggctcccttcccatgcgggtttcctggtttaagcacgaggaggagcta
acgaccagtgccaaatacacagtcgcgtttgcggaaggttctgcctctttggacataaaa
catctagacacgaacgattctggcatgtacacttgcagggccaccaactctgcgggcagc
aaagagggcagttgcactctggttgtaaaagagccacccagcttcattgtagagccagag
tcccaagaagtagctcccgggtcgacggtgcgcttgaagagttccttaaaagggacgcca
ccactcacaataaaatggtttaagggcgccagtgagctagagaccggcggagcctgctac
attatgactgaagccttagcgagttacttggaactctacgctgtaaagccctccgactca
ggggactacacttgccaagtcagcaacgtggcggggtccgttgcatgcagtgcaaacttg
tttgtgaaagaacctgccacctttgttgagaagctagagccatccctgctgttaaagaaa
ggagattatgtgcaattagattgtcaagtagtcggcaccaaaccgattaaaatcacctgg
ttcaaaggtgaccgggaaattcacgaaagtgacaaatacaagatgtcttttgtgggctct
aaagcgactctgcaacttacagaagtggcaatcgaagacagtggagaatatatctgtgag
gccaaaaatgatggcggcaaagatatttgcagtagtgttgtctcggtcaaagagtcacct
tattttagcaaggagtttgaatccctggaagtactgaaggattctgatgtggttttggag
tgccaggtgttggggacacctccatttgaagtcttttggttgaaagacaacaagccagtc
agaagtagtaggaggcacagactaagcactgaggattccttgattagcctccacgtgttt
aggtttgatgcctcagatgttggagaataccagtgcagaataactaacgcagtaggaagc
tgcgtctgcagtgctgaggtgaccctcaaagagcccccgcaatttgtgaagaagattgaa
aacattagctcgcttagaggaggcaccgctgtgtttcaggccgccctgaagggctctttg
cctatcacggtgtcttggctgaaagataacgatgacgtaattgaggatagcaacatcaaa
atgacgtttgtgaacaacgtagccactctccttgtcaggtctattgaagtgaagcatgac
gggaaatatttctgtcaggctaagaacgatgcgggaatacaaaggtgctcagctctacta
acagtgaaagaacctgcaactataactgacaaggccgtgtcaattgacgtcactgaggga
gacccagcaaccttacagtgtagattttcaggcactaaagacattacagccaaatggttc
aaagacggaaaggagctgactttgggcccgaaatataaaatcagtgttacagaccaagtc
tccgtcttaaagatcattcacacggaaaagaaagatagtggagaatacacttttgaggtt
caaaatgatgttgggagcagcagctgtaccgctagcatgaatgtgctagatcttatcata
ccgcccaaattcacaaaaaagttaaagaaaatggacagcattaagggttctttcattcac
ttagagtgcatagtgtctggttcacatcctataagtatccagtggcacaaggatggccaa
gagataacggctagtgaaaaatacaaatattccttccatgataacactgcattcctggaa
atcaatcagctggaaggtgcagacagcggatcttatacttgtgaggcaacaaataaagca
ggaagtaaccactgcagtggatatttgacagtcaaagaacccccgtattttgtggaaaag
ccacagtcgcaagatgttatacccaatgctagagttctgttcaaagctcttgtgaatggc
accactcctatgcagataaagtggtttaaagatagcaaagaacttatttccggagctact
cgctctgtctggaaggatgacacctcaagtgtgctagaactgttttcagcaaagacttct
gattcaggaaactatacctgtcaaataagcaatgacgttgggacagctacttccaaagca
gccctgtttgtgaaagaaccacccaagtttattcagaagcctagtcctgtagtagttttg
agaaaaggacaatccactactttcgaatgccaagtagcaggcacgcccgcaatccacatt
acgtggtacatggatgggaatgaaataactgaccctgctaagtatgacattgcattcgta
gacggttttgccactttcaaagttaccagtgcgaaagtagaggatagtgggatttatgtt
tgtgaggctcacaatgacgcaggtagtgaaagctgcagcattgaactgaaagtgaaagaa
cctcccacattcataagggagttgaaacctgctgaagtagtgaagggttttgatgccttg
ctggaatgtgaagtctccggcactcctccgtttgaagtaacgtggctgaagaataacaag
gagattcgcagcagcaaaaaatacgccatgagcgacaaggaatcagtattcacccttgtc
gtaaccaactgcgatttttcagatgctggggaataccagtgcattatatccaatgatggg
ggtagttgttcttgcagcaccaaagtcagtttgaaagaaccaccctccttcataaagaag
atagaaaatgtcactacggttttgaaaagttccgctgttttccaatgcactgtagcgggt
gctcatccgttgacagtgtcatggataaaagatgaaaaaattatcgaggaagatgagaac
gtccatattacgttcgagaacaatgtggccactctgaaaataaaacatattgatattggt
caccgggggaggtacacctgccaggcaaagaatgagtcaggagttgaaaaatgctttgct
ttgctcttagtacaagaagctgctcagatcatagaaaaggctaagtcagttaaagtaact
gaaagagacccagtgaccttggaatgcactgtggccggaacaccagaactcaaattgaaa
tggtttaaagatggcaaacagcttcttcccagtagatattataccatgagctttgacaat
aacgtggccagtttcaggattgaatcggtaatgaaggaggacagtggtacctacgctttt
aaagttgaaaacgattttggaagcagcacctgtgaatctgttttgacagtgttagatcaa
acaattcctccatcatttaccaaaaagttaacgaaaatagatcaagttctgggctcgtca
gttcatatggattgtaaagtttctggctcactccccattactgctaaatggtataaagat
ggaaaagaattacatgatagtgcaaaatacaggagcctgtgccatgagaatactgtatca
atggagattttaaatctggagttggcagatactgcaaattacacgtgtagtgtgactaat
gttgcgggaagtgactcttgcagtgccgtcttaacagtgaaagagccagcaagcttccta
gtaaaacccgaaaaccagcaagccatcccgaattctatggtggagtttaaggctgtgttg
aaaggaacaccaccgtttacaataaaatggtttaaagaagatttggaacttgtttctgga
gctaattgttatattgggatagaaggatcaacgggtttcttaaatctctattcggtggat
atttcaaagagtggacactatacctgccaagtttccaatgacgttggtagcgattcttgt
actgcaaccttgctggtaacagaacctccgaagtttgttaagaagctagaagcatcaaaa
gtagtaaaacagggtgactcggcacgacttgaatgcaaaataagcggatccccagaaatc
cgagtggtatggtacagaaatgacagtgaaatcattgccagtgacaaattcaggatgtcg
ttcagtgattctgtggcggtgattgaaatgaaccatctgagtactgaagacagcggggat
tacatatgtgaggctcacaatcctgctggcaggacgagctgcagtacaaaggttatagtg
aaagaacctcctgtttttagcaggaagccttctcctgtagacatgctcaaaggcactgac
gtgagtcttgaatgtgaaatttctggaacgccccctttcgaagttatgtggtataaagat
aagcgacaaatccgcagcagtaaaaagtataaggtcacctccaaaaattaccatgcgagt
attcacattcttaaggttgaagcctcagacattggtgaataccagtgcaaagcacagaac
gacgtcgggagtgactcttgcatttgcacagtaaaactgaaagaaccaccaaaattcgtg
acgaaaataagcagtatctcagttgtgattggtgaaccagtagaattacaagcaagagtg
gaaggttctcagcctatttctgtccagtggcttaaagacaaggaagaagtcatcagagaa
agtgaaaacaccaggattacgtttgtggaaaacattgcaactctacagcttgcaaatgcg
gaaccaggcagtgcgggaaagtatatctgtcagatcaggaatgatgctggaagtcgggaa
tgcatggctaccttaaccgttctagagccggcaatcattgtagagaaggcagagccaatg
cgagtgactgtgggagatgtttgcacattagagtgcaaagtggctggcacacccgaactt
tcagttgggtggtttaaggatggaaaagaactgacaagcagccacaaatacaaaattact
gtccacaacaaagtatctacgcttaaaattctcgattcagaaaagggagacagcggcata
tatactttcgcagtgcaaaacgatgttgggaaaagcagctgcacagcctccgttgatgtc
ttagatcgaattattccgccttctttcacacgaaaattaaaagacacaaacggcgtgctg
ggcttatcggcgcttctggagtgcaaagtatccggatcgccacctatttctgttgcctgg
tttcaagatggaaataagatagttagtggagaaaaacatcaaacctcgttttcagataat
ctctgtgttttgcaactgaattcactgaatgcatcagatacgggaggttacacctgcaaa
gctactaatgtagctgggtctgatgaatgcagggcagtattgaccgtacaagaatcccct
tcttttgtgaagaaacccgaacccgtggatgttttaccgggcacaagtgtcgctttcaca
agtgttatcagaggaacgcctccattcaaggtgaactggtttagaggggtcaatgaactt
gtgccaggatataaatgtaacatcagtttggaggattcggttgcagaactggagttgttt
gatgttgatccgcttcaaagcggagattatacttgcttagtgactaacgatgctggcaaa
gcatcctgtacagcacatctgtctgtaaaagaaccagcagtgtttgtgaagaagttgagt
gatcactgtgttgagcctggaaaccccatagttctggaaagcacatacactggtagcctc
ccgatctcggttatatggaagaagaatggcaagcctataactcagtctgaaaaatgcaac
atcgtcacaacggaaaaatcttgcattctggagattcttaatagtacaaaagaagatgaa
ggagaatacacttgccatgttgaaaacgaggcaggaggggatgtttgtgaagcactggtg
tcgacattagaacctccttattttgttacacaattgggacctctggaagtgtcagttgga
gattacacgactttgcattgccatgttgctggaacaccagaaataacagtatcttggtac
aaaggagatacaaaactaagatctactcctgagtataaaatgttctttaaagataatgtt
gctactctagtgtttaacaaagtggatagcaatgacagtggagaatatatatgcaaagca
gaaaacagtataggaactgcaactacaacggctctcttaacagttcaagcgcgcaaactt
ccgccttcctttgcaagaaaattaaaggacattgaacaaacagttggcttaccagttaaa
tttacgtgtcgcctaaatggctcagaacctattagcgtggcttggtataaaaatggtgta
cctttaagagatgaccattatgtgcaaacctcattcgtagagaatgtagcgattcttcag
ctgtctcaaaccgagatgagtcacactggacaatactcttgcacggcgactaatgctgtt
ggaactgctacttctagcgctaggctcacagtctcagaacccaagcaacctccttccttt
gatataacaccagcatccttggaagttccgagtggagaaagtgcggattttgaatgtcat
gttactggaacccaaccaataaatgtcacctgggcaaaagatggcagagaaatccgaatg
ggaggaaactataatattacctttatagcaaatacagctcacctgagaattctgagagca
ggcaaaggagactctggccagtatacctgccaagcaagcaacgaaattggaaaaaacttt
tgctcagcccaacttaatgtcaaagaagcgccaaagtttgtaaagaaattagaagcttca
cgtttcgtgaaacagggggattcagttcaactggagtgcaaaataagcggctccccggaa
atcaaagttgtgtggtacagaaacgacgctgaaatccatgctagtgagaaatacaagatg
tcattcagtgactctgtggcagttctcaccgttactgatgctggcattgaagacagtggt
gattacatttgcgaggctcacaattctgctggctctgcaagctgcagtactgttgtcaca
gtgaaagaacctcctgtttttagcaagaaacctacccctgtagagacacttaaagattcg
gacgttgtcattcaatgtgaaatttcgggaactccgccatttgaagtggcatggttcaaa
gacaggaggcaagtgagaagcagtaagaagttcaaagttacatctaaagacttcacagcc
agcgttcacattctgaacctcgaaacttcagacactggggagtaccaatgcaaagccatg
aacgaggtgggaagtgacacttgtgtttgtgctgtgaaattcaaagaacctccaagattt
gttcagaagttaagtgacacggtagcctttgttggagaaccgactacgctgcaagctgta
gtggaaggctctcagcctatttctgttttgtggcttaaggataagggcgacatcatcaga
gaaagcgaaaatgtccagatttcctttatggataatattgctattcttgagctcggaagc
acggaaggagccaacactggaaagtatatctgccagatcaaaaatgacgctggaatgaga
gagtgttcagcatttttacaagtattagagccagcagtaattttagaaaagccagagccg
atgtcagtcacagctgggaattcttttacattggagtgcacggtgggtggaacaccagag
cttattacaaagtggtataaggatggaagagaactacagagcggccgcaaatatcaaatc
acctttttcaacaaagtagctaccctgaaagttctttctgcggacgggggagaccgggga
ctgtatacatttgaagtgcgaaacgaagttggtgaaagtagctgcacatcctcagttgat
gtttcagatcgcattgcccctccttttttcacaagaaagttaaaggaaacatacggaatc
ctaggttcttcggcgctactagagtgcaaagtttcgggatcggcgcccatttcagttgcc
tggttacaagacggaaatgagattgttagtggcgacaaatatgaaatctctttctcagac
aacgtctgtagattgaaactgaatgcactggacgcatcagatacaggaccttacacctgc
gtcgctacaaatgtagctgggtctgatgaatgcagtgccttttttattgtacaagaacca
ccctccttcgcgaagacacctgatcccgtggaagttctacctgggatgagtgtaacattc
acaagtctcataaaaggaacggctccgttcaaagttaactggttcagaggcatcagggag
cttgtgtcagacagtacctgcaacatctctttggaggatacagtagcagaactggaactg
tatgaagtggaaccattccacagtggggattacacctgtcgagtcactaatgatgctggc
agtgtgtcttgtaccactcatctttttgtaaaagagccagccacatttgtgaagaaatta
agtgatttcagtgtagagcaagggaaatccatacttttggaaagcacatacaaaggaacg
cctcctatttctgtaacatggaagaagaacggcattcccttaacacagtctccgagatgt
agcataacaagtactgaaaaatccggcattctggaaattcctagcagtacaaaagacgat
gagggggagtacacttgcgaggttgcgaatgatgctggagcagatctttgccaaggcctc
atatcaatcctagaaccaccttattttgttacacactttgaacgggtggaggtgacagtc
ggcgagtccgcaacctttcagtgtcaaatttctgggacgccggaaatcaaagtctcgtgg
tacaaagacgatacaaaactaagatcgaccccggcttataaaatgtatttcaaaaacaat
gtggcaacgttagttttcaacaaggtggagagcagtgaccttggagaatacgtctgcaga
gcggaaaacagcgttggatttgcatcttccacagctctgctcacggttaaagaccgtaag
tttccacctacctttgcaaaaaaactgaaagacatccacgagaccgtgggttcccccatt
accttcgattgtcgcatcaatggctcggaacctattgaggtgtcatggcataaggacggg
gagttgctacacgatgatgagaacacacaaacaacattcttaaacaacgtggccactctc
cagatcttgcagaccaccatgactcactgtggtcaatactcgtgctcagctcaaaatgct
ctggggagcgcttcttccagtggcaggctcctcctcacagaacatctgagacctccggtc
tttgatgtgaaacctgtacctattgaggtggctcttggagcaagcggttcctttaaatgt
cacgtcactggatcagcgccactaaaagtcacttgggcaaaagataacagagatatccgc
cctgggggcaactacaagatcaccctggtggaaaacattgccagcttgacagttctgaaa
gtaggcaaaggagacgctggactatacacttgttatgcgagcaacaatgttggaaaagat
tcttgcgcagctcagctaagtgtgaaagaaccaccaaggtttattaagaagctagactcc
tctcgagttgtgaagcagcatgattccaccagatatgaatgcaaaataggtggctcccca
gaaatcagtgtcacctggtacaaaaatgaaactgaaatccatgatagtgaaaaatataga
atgtccttcatagacactgtggcagtccttgatatgcacaatctcagtgtggaagacagt
ggagactacacttgtgaagctcgcaatgcagcgggtgctgcaaacaccagtacctcattg
aaagtaaaagaaccccctgctttcagcaagaaaccccatccagttgagacgttgaggggt
tcagatgttcattttgaatgcgaacttcagggcactcccccattccagatttcatggtat
aaggacaaaagagagattcgaagcagcaagaagtacaaaatcatgtctgagaactacttg
gctagtattcacattcttagcgtgggtgatgcagacatcggcgaatatcactgtaaagct
gtaaatgatgtgggaggtgacacttgcgtttccactataacactaagagcaccaccgatt
tttgtgaagaagctcagtgatgtcactgctgtagttggagaggaagttgagcttcaggcc
acagtagaaggtgcccagcccatttccgttctgtggatgaaagacaaaggggatatcgtt
agagaaagtgaaaatcttgggatttcctattcagaaaacgttgcctcgctacggattgga
aatgcagaaccagccagtgctggaaaatacatctgtcagatcaaaaatgatgctggagtt
caggagtgctatgccactttgtcagttctagaacctgcagtcattgtagagaagccaagc
ccaatgaaagtcacatctggagactcgtgtaccctagaatgcacagtggatggcacaccg
gagctcactgctaggtggtttaaggatgggaacgaactatctaccgatcacaaatacaaa
attagcttcttcaacaaagtgtctgggcttaaaatccttgatgcaagggtagaagacagt
ggggaatatacatttgaagtgaaaaacagtgttggtaaaagcagttgtacagcttcagtg
cgtgtttcagatcgcattatacctccttctttcacaagaaaactgaaagaagccaatggt
ctcttgggttcgtctgttgttctggagtgtaaagtgtatgggtcaccgcctatttctgtt
tcctggttccatgatggacaggagctcactagtggagacaagtatcagacagcccttaca
gacaatgcttgctctttgaaagttaatgcactagaggagtctgatatgggaacttactca
tgcacggcgaataatgtagctggatctgatgaatgcagtgcatatttgactgttagagaa
cctccttcttttgtgaagaaacctgatcccttgcaagtgttatctggggcaaacatcacc
tttactagtatcctccaaggcacccctccattggatgttaaatggtttagaggtagcgtt
gagctattaccgggacatacatgcaacatctccctggaaaaatcagttgcacaattggag
ctgtatggtgttcagccacaccaaagtggagactacagctgcctggtgactaacgaggct
ggcaaagtttcttgcacaacacagctctttgtgaaagaaccagccaaatttgtgaaaaaa
ctgaataatctgagtgtagaaaaaggaaaatcattaattctggaatgcacatattccggt
acctctccgattgccgtcgtgtggaagaaaaatggatttgaaatagctcattctgaaaaa
tgcagcatgactaccacagaaacgtctgccatcctggaagtttccagtagcacaatagaa
gatcagggacagtacacttgcaacattgagaatgattctggactagatctttgtaaagct
gacgtctcagtattagaaccaccttattttgttacacgcttggaacctgctcaagtgact
gttggggattctgtgtcgttgcaatgccaggttgctggcacaccggaaattactgtatcg
tggtacaaaggagatacaaaactacgagcaactcctacctctaaaatgcactttaagaac
aatgttgccactttggttttcagccaggtggatactggagatagtggggagtatatctgc
aaagcagaaaacagtgtaggagaagcttcttcatcagctttgctttctgttcaagagcgt
aaacttcctccttcgttcacacaaactttgagagacattcatgaaactgttggcttacca
gttacgtttgattgtggtataactggctcagaacctattgaagtatcctggactaaagat
ggcgcacctatccgagaggactacacagtgcaaatgtcattcttaaataacgaagcaacg
ctccagtttttgcagaccgacaagagccttgctgggcagtacacttgtacagcttccaat
gctattggaactgcttcttccagtgctaggcttgtgcttacagaagggaagaatcctcca
ttgtttgacatcccaattgcatccatggatgcttttgctggggaaagtgctgactttgaa
tgccatgtatcaggctcacaaccaattaaagtcacttgggcaaaaaataacgaagagata
cggactggaggaaaataccagatcagttatgtagaaaacatagcccatttgacaattctg
aatgctgacaattcggactctggaacttatacatgccaggctagcaatgaagttggaaag
gactcttgcacagctcagcttagcattaaagaacgaaaaattccacctagttttacaaag
aaactatctgaagcagtagaagaaacagaaggcaacaccttgaaacttgagggttgtgtt
actggttctcagcctctgaccgttgcctggtataaaaacaaccaagaattctatcagagt
gctaactgtgaaatatcattccaaaacaacattatacttctgctgattaagagtgcaggg
caggctgatgctggcttgtatacctgcaaagtgtccaacgaagcaggaagtgtattgtgt
acgtcctccgttattattaaagaaccagcagtaattttagaaaagccagaaccgatgtcc
gttacagaaggggattcttttacattggagtgcacagtgggtggaacaccagaacttatt
acaaagtggtataaagatggaagagaactacagagcggccgcaaatatcaaataaccttt
tccaacaaagtagctaccctgaaagttctttctgcggacgggggagataggggactatat
acatttgaagtccaaaatgaagttggtaaaagtagctgcacatcctcagttgatgtttca
gatcgcattgtccctccttttttcacaagaaagttaaaggaaacatacgggatcctaggt
tcctcggcgctgctggaatgcaaagtttcgggatcgcttcccatttcagtcgcctggttc
cacaatagaaaggagattgttagtggcgacaaatatgaaatctctttctcagacaatgtc
tgtggattgaaactgaatgcactggacacatcagatacaggaccttacgcctgtgttgct
gcaaatgtagctgggtctgatgaatgcagtgccttttttattgtaaaagagccaccctcc
ttcgtgaagacacctgatcctatggaggtgcttcctaggatgagagtaacactcacaagc
ctcataaaaggaacggctccgttcaaagttaattggttcagaggcactagggagcttatg
tcagacagtacctgcagcatctctctggaggatacagttgcagaactggaactgtatgaa
gtggaactattccacagtggggattacacctgtcgagtcactaatgacgctggcagtgtg
tcttgtaccactcatcttcttgtaaaagagccagccacacttgtgaagaaaataagtgat
ttcggtgtagagcaagggaaatccatacttctgcaaagcacgtacaaaggaactcctcct
atttcagtaacatggaagaagaatggctttccgttaacacagtccccaagatgtgcaata
acaagtactgaaaaatcaagcatagtggaaattcttaatagtacgaaagatgatgaaggg
gaatacgcttgtgaggttgcgaatgatgctggagcagatctttgtcaaggcttaatatca
atcctagaaccaccttattttgtttcacatttggaacgggtagaggtgacctttggaaag
cctgcatctttagagtgccaaattgctgggacaccagaaatcaaagtttcatggtacaaa
gaagacacaaaactaaagtcgactcctacatataaaatgtacttcaaaaacaatgtggct
aagttagttttcagtcgggtggagagcagtgaccttggagaatacgtctgcaaagcagaa
aacaatgttggctttgcctcttccacagctctgctcacagttaaagaccgtaagtttcca
cctacctttgcaagaaaactgaaagacatccacgagaccgtgggttcccccattaccttc
gattgtcgcatcaatggctcggaacctattgaggtgtcatggcataaggacggggagttg
ctacacgatgatgagaacacacaaacaacattcttaaacaacgtggccactctccagatc
ttgcagaccaccatggctcactgtggccaatactcatgctcagctcaaaatgctcttggg
agtgcttcttccagtgccacacttctgctcacagagcatctgagacctccagtctttgat
gtgaaacctgtacctattgaggtggctcttggagcaagcggttcctttaaatgtcacgtc
actggatcagcgccactaaaagtcacttgggcaaaagataacagagatatccgccctggg
ggcaactacaagatcaccctggtggaaaacattgccagcttgacagttctgaaagtaggc
aaaggagacgctggactatacacttgttatgcgagcaacaatgttggaaaagattcttgc
gcagctcagctaagtgtgaaagaaccaccaaggtttattaagaagctagactcctctcga
gttgtgaagcagcatgattccaccagatatgaatgcaaaataggtggctccccagaaatc
aaagtcacctggtacaaagacgaaactgaaatccatgacagtgaaaaatatagaatgtcc
ttcatagatactgtggcagtccttgatatgcacaatctcagtgtggaagacagtggagac
tacacttgtgaagctcgcaatacagcgggtactgcaaacaccagtatctcattgaaagtg
aaagcaccccctgttttcagcaagaaaccccatccagttgagactttgaaaggtttagat
gttcatcttgagtgtgaacttcggggcactcctccattccagattacatggtataaggac
aaaagagagattagaagtaccaagaagtacaaaatcatgtccgagaaccatcttgctagt
attcatattcttagtatgagtgatgcagacgtcggtgaatatcactgtaaggccgtaaat
gatgtgggaagtgaaacttgcatttgctttatcactctaaaagcggcaccaatttttgtg
aagaaactcaatgatgtcactgctgtagttggggaagcagttgagttgcaggctaccata
ggaggtgcccagcccatttctgttctgtggatgaaagacaaaggggaaatcgttagagaa
agtgaaaataattggatttcctattcagaaaacattgccaccctacggattggaaatgcg
actccagccactgctggaaaatacatctgtcagataaaaaatgatgcaggagttcaggag
tgctttgctactttgtcagttctagaacctgcagtcattgtagagaagccaggcccaatg
aaagtcacatctggagactcgtgtaccctagaatgcacagtggacggcacaccggagctc
attgctaagtggtttaaagatgggaaggagctgtccactgatcacaaatacaaaattagc
ttagtcaacaaagtgtctgtgcttaagatcctcaatgcaggaatacaagacaccggggag
tatatttttgaagtgaaaaacagtgttggtaaaagcaggtgcacagcttcagtgcgtgtt
tcagatcgcattttgccaccttctttcacaagaaaactgaaagacattaatggtctcttg
ggttcttctgttgtgctggattgcaaagtgtctgggtcaccacctctttctgtttcctgg
ttccacgatgggcatgagatcactggtggagacaagtatcagttgactctcacagacaat
acctgcagtttgaaagtgagcacactagaggaatctgataaaggaacttactcatgcacg
gcgaataatgtagctggatctgatgaatgcagtgcatatctgactattagagaacctcct
tcttttgtgaagaaacctgatcccttgcaagtgttatctggggcaaacatcacctttact
agtatcctccaaggcacccctccactggatgttaaatggtttagaggtagcgttgaacta
gtatcaggccatagatgcaacatctccctggaaaattcagttgcagaactggagctgttt
gatgtactgccactccaaagtggagagtatacctgcctggtgactaacgaggctggcaaa
gtttcttgcacaacacagctctttgtgaaagaaccagccaaatttgtgaaaaaattgaat
aacctcagtgtagagaaaggaaaaccattaattctggaatgctcatactctggtacccct
ccgattgccatcgtttggaagaaaaatggaatccaaatagttcatactgcaaaatgcagc
atcaccaccacagaaacatctgccattctagaagttcccagtagcacaatagaagatcaa
ggacagtacacttgccacattgaaaatgattctgggcaagatatttgtcactctacagtc
tcagtattagaacctcctcattttgttacacgcttggaacctgctcaggtgactgttggg
gattctgtgtcgttgcaatgccaggttgctggcacaccggaaattactgtatcgtggtac
aaaggagatacaaaactacgagcaactcctacctctaaaatgcactttaagaacaatgtt
gccactttggttttcagccaggtggacactggagatagtggggagtatatctgcaaagca
gaaaacagtgtaggagaagcttcttcatcagctttgctttctgttcaagagcgaaaactt
cctccttcattcatacgaactttgagagatattcacgaaactgttggtttatcagttacg
tttgactgtcgcataactggttcagaacctattgaagtatcctggtctaaagatggcgca
cctatccgagagggctacaatgtgcaaatgtcattcttaaataacgaagccacactccag
tttttgcagaccgacaagagccttgctgggcagtacacttgtacagcttccaatgctatt
ggaactgcttcttccagtgccaggcttgtgcttacagaagggaagaatcctccattgttt
gacatcccaattgtatctatggatgcttttgctggggaaagtgctgactttgaatgccat
gtatcaggaacacaaccaattaaaatcacttgggcaaaaaataatgaagagatacggact
ggaagaaagtaccagatcagttatatagaaaacatagcccatttgacaattctgagtgtt
gacagttcagactctggaacttatacatgccaggctagcaacgaagttggaaaagactct
tgcacagctcagcttagcattaaagaacgaaaaattccacctagttttacaaagaaactg
tctgaaacagtagaagaaacagaaggcaatgccctgaaacttgaaggccgtgtttctggt
tctcagcctctgaccattgcctggtataaaaacaaccaagagatctatcagagtcgtaat
tgtgaaatatcattccaaaacaacattatacttcttcaaattatgagtgcagggcaagct
gatgctggtttatatacctgcaaagtgtccaacgaagcaggaagtgtattgtgtacatct
tccgttgttattaaagaaccaaaaaagccaccagtgtttgaccaacctcttaggccagtg
acaatagcagaagaagacattttgcagctcagctgccacgtccagggatcccagccaatc
aggattcagtggctgaaggctgggaaagaaataaaagcttcagataaatgcaacattagt
tttgctgatggaacagctcttttggaactcactgcagttactaaaactgatgcaggcgaa
tatatgtgcaaagctaccaatgtagctggaagtgactcttgcaagtcaaaagtgacagta
aaagaaaaaccagcagctgcaccagcagttaagaaagcaccagtggatggaaagctgtac
ttcatctcagagcctcagaatctcaaagttgtggaaaagagtgttgcaacttttattgca
aaagttggaggtgatccaatcccaaatgttaaatggactaagggaaagtggagacaactc
aatcagggaggtcgtattatcatccagcaaagaggaaatgaagccaaactagaaataaag
gatgcaacaaaaactgattctggacaatacagatgtgtagcttttaatgaccatggtgaa
attgagagcagtgccaacctacaagttgaagaaagaagacaagaggtgattgaaggagat
ctgagagcaaaactgaagagtactccaaccaaaaagaaggaggaggaggaggaagagaaa
cccattgatatcatggaacttctcaaaaacgttgatcctaaagaatatgaaaagtatgct
cgcatgtatggaattacagatttccgtggcctcctgcaagcctttgagctgctaaagcaa
agccaagaggaagaaagccatagattggaaattgaagtcacagagagagctcgcaaagaa
gaacaggaatttgatgaactagtatcatttattcaacaaagactcacgcagacagagcct
atcactctcatcagggatattgaaaaccagagcgttgtagcaaatgaggatgctgtcttt
gaatgtgaaattaagattaattatcctgaaatcaaactctcctggtacaaaggaactcaa
aaattggaccccagtaacaagtatgaaataagaattaaaggtgatcggcacatacttaga
atcaagaactgccaacctacagatcaaggaaattacagaattgtctgtggtccacatatt
gctagtgctaagctaactgtgattgaaccaccaacgattattacaaagctagatttttct
agagttgtaaaacagcatgattccaccagatatgaatgcaaaataagtggctctccagaa
atcaaaatcacctggtacaaaaatgaaactgaaatcgatgacagtgaaaaatacagaatg
tcctttattgattctgtagcagtcattgaaatgcacaaactcagtgtggaagacagcgga
gactacatttgtgaagctcgtaatgcagcaggcgctgcaagcaccagtacctcattgaaa
gtgaaagcaccccctgttttcagcaagaagccccatccagttgagactttgaaaggttta
gacgttcatcttgagtgtgaacttcagggcactcctccattccagatttcatggtataag
gacaaaacagagattacaagtagcaagaagtacaaaatcatgtctgagaactaccttgct
agtattcacattttgagtgtggatgctgcagatgtcggtgaatatcactgtaaggcggta
aatgatgttggaagtgacacttgcatttgctttatagctctacaagcaccaccaattttt
gtgaagaaactgagtgatgtcactgctgtagttggggaggcagtcgagctgcaggccact
gtagatggatcccagcccatttctgttctgtggatgaaagacaaaggggaaatcataaca
gaaagtgaaaatcttaggatttcctattcagaaaacgttgccactctacggattggaaat
gcgacaccagccactgctggaaaatacatctgtcagatcaaaaatgatgcaggagttcag
gagtgctttgccagtctctccattctagaacctgcagtcattgtagagaagccaggctca
atgaaagtcacatctggagactcgtgtacccttgaatgcacagtggacggcacaccggag
ctctctgctaggtggtttaagaatgggaaggagctatctaccaatcaaaaatacaaaatt
agcttcatcaacaaagtgtctgggcttaagatcctcaatgcaaaagtagaagacagtggg
gaatatacttttgaggtgaaaaacaatgttggtaaaagcagatgcacagcttcagtgcgt
gtttcagatcgcattttaccaccttctttcacaagaaaactgaaagatattaatggtctg
actggttcttctgttatgctggattgcaaagtgtcgggatcaccacctttttctgtttcc
tggttccacgatggacacgagatcaccagtggagacaagtatcagacgacccttacggac
aatacttgctctttgaaagttaatgcactaaaggaatctgatatgggaacttattcatgc
acagctagtaatatagctggatcagatgaatgcagtgcatatttgactgttcgagaacct
ccatctttcgtaaagaaacctgatcccttgcaagttttatctggggcaaatataactttt
accagcatcctacaaggcactcttccattggatgttaaatggtttaaaggtagcgttgag
ttagtacctggacatacatgcaacatctccttggaaaatttggttgcagagctggagctc
tttgatgttcagccacaccaaagtggagactacagctgcctggtgactaatgaggctggc
aaaatttcttgcacaacacagctctttgtaaaagagccagccaaatttgtaaaaaaactg
aataacctcagtgtagagaaaggaaaaccattaattttggaatgcacgtactctggtact
cctccgattgccgttgtttggaagaaaaatggattcaaagtagttcattctgcaaaatgt
agcatcaccaccacagaaacatctgccatcctggaagttccttatagcaaaatagaagat
cagggacagtacacttgccacattgagaatgattctggacgagatctttgtcaagctgac
atctcagtattagaaccaccttattttgttacacgtttggaacctgttcaggtgattgtt
ggggattctgcatcattgcaatgccaagttgctggcacaccagaaattactatatcgtgg
tacaaaggagatacaaaactacgagcaactcctacctctaaaatgtactttaagaacaac
gttgccactttggtttttagccaggtggatatcggagatagtgggaagtatatttgcaaa
gcagaaaacagtgtaggagaagcttcctcatcagctttgctttctgttcaagagcgtaaa
tttcctccttcattcacacaaactttgagagacattcatgaaactgttggcttaccagtt
acatttgactgtggcataactggttcagaacctattaaagtatcctggactaaagatggc
gtatctatccgagatggctacaatgtgcaaacatcattcttaaataatgtagcaacactc
cagtttttgcagaccgacaagagccttgctgggcagtacacttgtacagcttccaatgct
attggaactgcttcttccagtgccaggctcgtgcttacagaagggaagaatcctcctttg
tttgacatcccaattgcatccgtggatgcttttgctggggaaagtgctgaatttgaatgt
catatatcaggaactcaaccaattaaggtcacttgggcaaaaaataaccaagagattcgg
agtggaagaaagtaccagattagttatgtagacaacacagcttatttgacaattctgaat
gttgacaatgcagactctggaacttatacatgccaggctagtaatgaagttggaaaggac
tcttgcacagcccaactaaatattaaagaacgaaaaattccacctagttttacaaagaaa
ccatctgaaacagtagaagaaacagaaggcaacactttgaaacttgagggccgtgtttct
ggttctcagcctctaactattgcttggtataaaaacaatcaagaaattgatgagagtcct
aattgtgaaatatcgttcctaaagaacaccatagttctgcagattaagagcgtaggacag
gccgatgctggcttatatacctgcaaagtgtccaatgaagcaggaagtatattgtgcact
tcctctgttgtcgttaaagaaccaaaaaagccaccagtgtttgatcaacctcttaggcca
gtgacaatagcagaaggagacattttgcagctcagctgccatgtccagggatcccagcca
atcaggattcagtggctaaaggctgggagagaaataaaagcttcagataaatgcaacatt
agttttgctgatggaacagcccttttggaactcactgcagttactaaaacggatgcaggc
gaatacgtgtgcaaagctaccaatatagccggaagtgactcttgcaagtcaaaagtgaca
gtaaaagaaaaaacagcagctgcaccagcagctaagaaagcaccagtggacggaaagctg
tacttcatttcagagcctcagaatcttaaaattgtggaaaagagtgttgcaacttttatt
gcaaaagttggaggtgatccaatcccaaatgttaaatggactaagggaaaatggagacaa
cttaatcggggaggtcgcattttcatccagcagaaaggaaatgaagccaaactagaaata
aaggatgcaacaaaaactgattctggacaatacagatgtgtagcttttaatgaccatggt
gaaattgagaccagtgttgaacttcaagttgaagaaagaagaaaggaagaagcgattgaa
ggagatctgagagcaaaactgaagagtactccaaccaaaaagaaggaggaggaggaagaa
aaaccagttgatatcatggaaattctcaaaaatgttgaccctaaagaatatgagaagtat
gctctcatgtatggaattacagatttccgtggcctcctgcaagcctttgagctgctaaag
caaagccaagaggaagaaagccagagattggaaattgaagtcacagagagaactctcaaa
ggagaacaggatttggaagaacttgtatcatttattcatcaaagagtcacacagacagag
cctgtctcccttattatggatattgaaaaccagaccgttttagcagatgaggatgctgtc
tttgaatgtgaaattaagattaattatcctgaaatcaaactctcctggtacaaaggaact
caaaaactggaccctagtgacaagtatgaaataagaattaaaggtgatcagcacatcctc
agaatcaggaactgccaacctgcagatcaaggaaattacagagttgtctgtggatcacat
attggtagtgctaagctaactgtgatcgcacctgaagttgaacggaatcttcatgatact
gctttcaaggaaggacgcacatgcaccctgatttgtcagttctctatcccaaatgccaaa
tctcagtggtatcgaaatggaaaagccattaagataggagggagatattcaacacaagtc
tcagagaaaacacacaaactaatcatcaaagatgttagaacagaagaccagggacagtac
acctgcaagcttcacaatctagaaacaactgcagatctaaccattgaagctgagcctatt
cagttcacaaagagcatacagaatatagtggtgagtgaaaacgagtctgcaacctttgag
tgtgaggtttcttttgatgacgcagtagtgacatggtacaaaggctccattgaacttagg
gagagtcggaaatacagctttagaagtgaaggtcgctgtcattatatgactatccacaat
gtcactgcacaagatgaaggtgtgtattctgtaattgctcgtcttgaaccaaggggtgaa
gcaagaagcactgcagaactctatctgacaaccaaagaaatgaaactagaagtgaagcca
ccagatgttcctgatgccagagttgcagttccaattgaagcaccagctgaagatatccct
attcctgttttgctgccttttactgttccaccaccagaagacaagaaagagaccaagaaa
gttcttgaaaagaaagtctccaaaaaggtggtttcaaaagttcctgaagaaattacacca
cctaaagttcccaaagtgccaaaggacagacaagagatcaaaattacttctgaagctaga
agggaagaagttcatgaaaaggaggaaatatataaaaaaagagaagaggtttatgaacaa
aaagaagaaatttatgaagaacaaaaagaaccttatgaagaatgggaagaagattatgaa
gaagaacaggaatattatgaaagggaagattatgaagaaggggaagaggaatgggaaact
tatgaagaaaaacaggtttatcgtgaagaagtgattggagttcctcagaagcctgtgcct
gaacatatcacaccagaaattacagctgaaaagaaaaagaaggaagtaactgtgcataaa
gttgttaggaaacctgtagctgaggaagttgagatgaccactcagaggcttgaagaggag
gaagtcagactgcccaaagtgccagcagttcccaagaaagttccaccaccaaaacctacc
cgggtgccagttgaggaggaagaaattacaagaaagaaagtaccgactgtagaaatgtgg
actatttcagaagaaaagatgtctgtttctgttcatgcagaagaagaatattcatatgtc
ccagagccaaaagtacatgagagaactgtcatagaagaaaaagtacatgttgaaattcct
gaggctcccccagttccagttcctgaggtacgtaagagagaagaaaagaaaatacctgct
gctgttcccaaaaaggtggaggctccaccagttaaagtgcctgaggtgccaaagaaaact
gtcccagaaaagaaggaacctgttcctgtccctaaaaaagtagaagctccacctgctaaa
gtgccagaagtgcccaagaaacttgtgccagagaagaaagtacctgctgccgttcccaag
aaagaagtagctcctccagctaaagtgcctgaggtacctaagagacctgccccagaagaa
aaagttgctgttcctaaaagagaggaggctccaccagcaaaagtgcccgtagtgcctaag
agagctgtccctgaagaaaaattacctgttgctgttcctaaaaaagtggaggctccccca
gcaaaagagccaacagtacaagaatggatagaagaagaggaggaggaggaagaaatggtc
acttttgttcacagaaaagaggagatttcatcaattacagtgcttaagaaaaaaccacca
gacgaatggataccccctgttcctattgaaatagaagaacctcagttcactaaagtgtct
gaagtgcacacgaaaattatcacagaagaaaaagtagctatggctgaaaagcaggcagct
ccacccaaaaaagttccaaaagtgccccaaaaatctgtgccaggagataaagtgctgatt
ccagttcacaaaaaagtggttactccactggctaaaaatatttcagctctctctggggat
acaggagacttctacatatcaaaatttagtgagaaccaacaggccttggacctaagttcc
ccccgagcagccaaagtggaagagcattgggctttgtcagaagacgtgtccatctctctt
cacacagaggagcaggtttcatacacagtgtctgagattccggagagagtagtcatagaa
gaagtattaccaatttctatctctaaaaaagtgaagaagccaccaattaaagtggctgaa
gaagagccttgctatgtagaagaggaagtacctgtcgttgttcctaaaaaagttgaggct
ccaccagtgagagtgcttaagaaaaaaccaccagaagaatgggtaccccctgttcctatt
gaaatagaagaacctcagttcaccaaagtgactgaagtgcacaggaaaattatcatcgaa
gaaaaagtagctatgcctgaaaaagaggaggctccaccaaaaagagtgccaaaagtaccc
aagaaagctgtgccagaagagaaggtgcctgttccaatacacaaaaaagtggtggctcca
ccagctaaagtagctgaagaagagccttcctacatagaggaggaagtacctgtccctgtt
cctaaaaaagtggaagccccaccagctaaagtgcctgagaagcctaagaaagttgtccca
ccaccaaaagttcctgctgctcctaaaattgaggaagcaccaccagctaaagtgcctgaa
gttcataagaaagccattcctgaggagaaagtacctgttcctgttcctaaaaaagtggag
cccccaccagctagagcattaaagaaaaaaccaccagaagaatggatacctccagtacct
atagaaacagaagaacctcaattcaccaaagtgaccgaagtacataggaaaattgtcata
gaagaaaaagtagctatgtctgaaaaggaggagactccacccaaaaaagtgccagaagtg
cccaagaaacctgttccagaagagaaagtacctgttccggtacagaaaaaagcagtggct
tcgccagctaaagtaccagaagttccaattgctgttccaaagaaaacagcagctccacca
gccaaagtggaagagcattgggctttgtcagaagaagtctccatctctcttcacacagag
gaggaggtttcatacacagtgcctgatgttcccgagaaagtagtcatagaagaaaggtta
ccaatttctattactaaaaaggtgaagagaccaccagttaaagtgcctgaagaacgtaag
acagttgtccaaaaagaacaaatatatgttgaagttccccagtatgaagaggaagaggtc
acccattatgaagaggaagagaaagttacccagtatgaggaggaggaggaagaagaggaa
gtcaccctctatgaagaagaagtaacccaatatgaagagaaagttcctcaatatgaggag
gaggaagaggaagtgcctgaatatgaagaagaagctcccccaccagtgaaagtgcctgag
gtacccacaagacgtatcccagaggaaaaagtacctgttcccaagagaaaagaagctcct
ccagcgaaagtgccagagatgccacagaagcctgtgccagaagaaaaactgcccgttcct
gtgcccaaaagaaaggaagctccaccaactaaagtgccagagaaagctgttccagaagag
aaagtgcctgttccagagcctaaaaaagtggaagctccaccagctaaagttcctgctgtg
ctgaaaaaagctgttcctgaagagaaagttcctgttgctgtgcctaaaaaaccagaacct
gcccctgtgcctaaaaaatcagaaccaccaccacctcctaaagtgcccgaagtgcccaag
aaagctgtcccagaagaaaaagtacctgttcctaaagtaaagaaagctccatcagctaaa
gtgcctgaggtgccaaagaaacctgtcccagaagaaaaaatacctgtttccgttcccccc
aaaatggagcctccaccagcgaaagtgccagaggtgcctaagaaatctgtccctgaagag
aaagtatctgttcctaaaaaggtggaggctccagcagttaaagtgcctaagaagcctaag
gaagttgttcctgaagagaagatacctgttgctcctcttaaaaaagtagagcttcccgct
gtgaaagtccctgaggtacaaaagaaagcggttcctgaagaaaaagtcccagctgctgtt
cctaaaccaaaagaagctcctccggccaaagttcatgaggtacccaagaaacccagctgg
gaagaaagaatctctctgcctgttcctgcagaaaaggagtatgaatatgagtatgaaaag
tatgagacctatgaggctatagaagagtttgagattccggaacatgaagacattgaatat
gaggagcttccagagcctgaagagatttatgaggaggctccagaaccagaagagatttat
gaggaggttccagaaccagaagagatttatgaggaggttccagagcctgaagagaaatat
gagcagattcgtgtgactgaagaggtttatgaggaggttaaaaaggttgaggagatcttt
gaggaagcttacgaggtcacaccagctatagtgcctaaagtgcctaagagatctgtgcca
gaagaaaaaatacctgttgctgttcctaaaaaagaagctccaccagctaaagttcctgca
gtgcgtaagaaaccagtcccagaagaaaaagtacctgtcgctgttcctaaaaaagaagtg
cctccccctgccaaagtgcctgaggttcctgaaagagttgtccctgaagaaaaagcaccc
actcttattcctagagaagaggaaactgctccctatgaagtgcctgcagtgcccaaaaaa
gctgttcagcaaaagaaaatacctgctgctatatctaaaaaagaagctccaccaattaca
gagtctgtggttcctgggagagctgtgtcaccagaaaaaaaacctacagttgtccctaaa
aaagaagacgctctgccagctaaagtgcctgtgatgccaaagaaatctgttcccaaaaag
aaagtaccaattgctgtacccaatgaagaagctccaccttttaaagtacctgaggtttat
gaagaaattcccccagaagaaaaaatttctactgctattcctagaaaagaagaatctcca
caaatcacagtgcctgatgtgtccaagaaagctatcccagaaggaaaagtacaaattgct
gttccaaagaaaacagaacctccaccagccaaagtgcctgaagtgcccaaggaatctgtc
ccagaagagaaagtacccattgcagtttctaaaaagccagaagctccaccagctaaagtg
cctgaggtgcccaagaaagctatcccagaagaaaaagtgcaaattgctgtgcctaagaaa
gctgtgcctaaaaaaacagaacgtccaacagccaaagtgcctgaagtacccaaggaacct
gtcccagaaaagaaagtacctgttgcagcacctaaaaagccagaagttccaccagctaaa
gtgcctgaagagcccaagaaagctgtcctagaagagaaaataccagttgctaaaaagcca
gtacctccagcagttaaagtgcctgaggtgcccaaggaagtcccaaaggagaaagaaccc
gttgctgtgcctaaaaaaccagacgctccactagccaaagtgccagaggtgcccaagaaa
gctgctccagaagagaaagtaccagttactgtgcctaaaaaaccagaggctccaccagct
aaagtgcctgaggttccaaagaaagtggtcccagaagagaaactaccagttgctgtgcct
aaaaaaccagaaccgccaccagctaaagtgcctgaagtgccaaagaaagttgttattgaa
gaaaaagtaccagttgaagagcctgagaaaccagaacctccaccagctaaagtgcctgag
gtgtccaaaaaagaggtccctaaaaagaaagtaccagttgctgtacctaaaaaaccagaa
cctccaccagctaaagaacctgagatgcccaagtcagctgtcccagaagaggaagatttt
ctggctgtacctaaaaaaacagaacctccacctgcaaaagtgcctgaagtgcccaagaag
gctgttccagaagagaaaatacctcttgctgtgactaaaaagccagagcctcccccagct
aaagtgcctgaggaacccaggaaaactgtcccagaagagaaagtgcctgtgcctaaaaaa
gaagaacctactcctgttcctaagaaaccagaacctccaccaactaaagtgcctgaggtg
gccaagaaagatgtcctagaagaaaaagtaactgtgcctaagaaaccagaacctccacca
gccaaagtgcctgaggtgcccaagaaagatgtttcagaagaaaaagttcctgtgcctaag
aaaccagaacctccaccagctaaagtccctgaggtgtccaagaaagctgtcccagaagaa
aaagttcctgtgcctaaaaaaatagaacctactcctgtgcctaagaaaccagaacctcca
ccagctaaagtaaacagaactaatatctttaaagtgcctggggtgcccaagaaagatgtc
ctagaacaaaaagttcctgtgcctaaaaaaacagaacctccaccaaggcacttaaacagc
actaatatctttaaagtgcctggtgtgcccaagaaagccgtcccagaagaaaaaataaca
gtacctaaaaaaccaaaacctactcctgtgcctaaaaaaccagaacctccagcagcaaaa
gtgcctgaggtgcccaagaaagttgtcccagaagaaaaactgcctgttgctgtgcctaaa
aaaccagaatttgcacctgctaaagaattagaagagatctcactagcagaagaagaagag
atctccgcagctgaagaagagatctccgcagctgaagaagaggaaatctcatcagaagaa
atctctccagcagaagaagagatctcagcagttgaagagattgtaccaatagaagagcca
gaacctgaaaagaagattcctgaaaaaccaaaaccacgggtacctcttccaccaaaagag
gaagttaagatggaaaaagttcaacttaaagctcccacgccaaggaagaaagttgtgcct
gaaaaacctgttcaggctccagaaaaagtggaactcacgcctgctaaagtgccgggagtt
gaaaagaaaggccgcagaatacttcctgaagttacccctccgcctaaggaagaagttgtt
cttaaaagagttcctagaaagacacctgaagaggaaaaaccgaaaccagagaaagaacct
aaagtagaaacgaaaccagaacctaaaccagtagaaaagataaagaaacctgaagagcca
gaagttcccaagaagaaaattgagataccacctgtcacgaaaaaagaaaaacctgtgcct
gaaccagagaaagtgccagaacctaagccagcagctgtccctcttcctgaaccaaaaccc
acagaagctctaatatctcccaaattagccgaagaggcagcccctgttactgctccagtg
acgactccagtggttggaaagaaagcagatcccaaagcaccaaaagaagaacctggcaag
gttagaactcctattaaagccaagaagacaccatcccctgcagatctggataggaaaaaa
ctaaggccaggcagtggtggtgagaaacctcctgaagagccaccattcacctaccaactt
aaagctgtgccactgaagtttgtaaaggaaatgaaagacatagtactggaagaagctgaa
tctgttggttcttctgcgatctttgaggtccttatctctccctctactgcaattaccagc
tggatgaaagatggaaataacatccgagagagcccaaagcacaggtttattgcagatggc
aaagacaggaagctgcatattattgatgtccagctttcagatgctggcgagtacacttgt
gtgctacgtttgggaaacaaagaaaagacctccacagctaaactcattgttgaagaaata
ccagtgcgttttgtgaaaacacttgaggaacaagtcacagtggtcaaagggcagccattt
tatctaagctgtgagctgaacaaagagagagatgtggtatggaggaaggatgggaagatc
gtagtagacaagcccggaaagtatgcgctgggtattattggtttgcaacgtgcccttacc
atcatggatgcagatgacgctgatgctggcacttacacggtgacagtggacaacactgac
ctcaaatgcgactctgttgttcaagtaatagaagtgatacgagactggttggtgaaacct
ataagggaccagcatgtgaaaccaaagggtacagctacgtttgtttgcaatatggtcaag
gatacaccaaattttaaatggtacaagggagatgaggaaattccaactgaaccaactgat
aagacagagattgtgaaagaaggaaatctcattcacctcaaagttaagaatgctacacct
gaagatattggtgaatatgcgatagaaattgaaggtcgcagatatgcagctaaactgacc
cttggtgagcgtgaggtcgagctacttaaaccactggaagatgttacagtttatgagaaa
gaaacagcaagctttgacacggaaatttctgaagaagatattcctggagaatggaaactg
aaaggagaaatcctgaggccctcacctacttgtgaaatcaaatctgaaggaggaaaacgc
ttcctaaccttgcacaaagtcaagttggaacaggctggtgaagttctctaccaggcactc
aatgcgctcactacagccatcctgacagtgaaagaaatcgaacttgactttgctgtgcct
ctgaaagatgtcactgttcctgagaaacgtcaggctcggtttgaatgtgtcctcactcgg
gaagccaacgttatatggtctaagggcactgacatcatcaaagttggagacaaatttgac
atcattgcagatggaaagaaacacatccttgtagtcaatgattcacagtttgatgatgaa
ggagaatacactgctgaagtggaagggaagaagagcacagcaagattgtttgtagaaggt
atcaggttgaagttcctcacacctctaaaagatcaaacagtaaaagaaggggaaacggct
cactttgagttcgagctttctcatgaaaatatgctagtgagctggttcaaaaatgacaaa
aaactccacacaagcagaacggttctgattcatgcagaaggcaagattcacaaattagaa
atgagagaagtaactctggatgatatctctgagataaaggctgaagtcaagggcttgcac
accagtgcaaagctccgagtcttagaggccgatccatacttcactgtgaaattacaagac
tattctgcaatagagaaagatgatgttatcctggaatgcgaacttagcaaagatgtgccg
gtaaaatggtacaaagatggccaagagctaacagcttccaagagaatttccataaagact
gagggcctgcgccggatcctaaaaatcaaaaaaattgaagatggtgataaaggcaactat
gagtgtgactgtggaactgacaagacaaaagctaatgttaacattgagcctcgtataata
aaagtggagcgtcccctttatggagtggaggtatttgttggtgaaacagctcgttttgag
gttgaaatctctgagcctgatgttcaccctatctggaagttaaaaggagaaactttagca
ccttcacctaactgtgaaataattgaagatgggaagaaacatgttcttatcctttataat
tgcaaactggatatgactggagaagtgtcctttcaggctgcaaatgccaaaagcgcagct
aatctgaaagtgaaagaactacctctcatctttatcactccactcagtgatgtcaaggtc
tttgagaaagatgaggccagatttgaatgtgaggtgtctagggaaccaaagactttccgt
tggttgaaaggaacacaagagatcactggtgacgagaagtttgaaattatctcagagggc
accaggcatgccctggtaattaagacagttgcttttgaggatgaagctaaatatatgttt
gaagctgaagataaaagaacaagtgccaagctgatcattgaaggcattcgtctgaaattc
attactcctctcaaggatgtaacggccaaggagcgtgagactgcagagtttactgtagaa
ctgtcccatgataatatccctgttgcatggttcaagaatgaccaacgactacataccagt
aaggtgatttcaatgaaagatgatggcaaattccatacactcacaattaaagatctctcc
attgatgacacttctcagatcagagtggaagctatgaacaaatcctctgaagctaagctt
acagttgttgagggagatccttacttcactgcaaagcttcaggattacactgcagtagag
aaagatgaagtgattttacaatgtgaaattagcaaagcagatgctcctgtgaaatggttg
aaagatggcaaagaaataattccatcaaaaaatgttgtcatcaaggctgatggcaaaaag
agaatcctaatcctcaagaaggcattgaagaaagacattggatcatacacctgtgattgt
ggtactgaccaaacctctgccaaactcaacattgaagagcgggatattaagattgtgcgc
cacctgtacagtgtggaggtaattgagacagagactgcccgctttgatactgaaatctct
gaggaagatgtccatgccagctggaaactaaaaggagaaactctgaaccaatcacctgag
tgtgaaattaaggaggaaggcaaaaagcactttctcgtattgtacaatgtacgtttggac
caagctggtggagtggatttccaagcagcaaatgccaaatccagtgctcaccttcgagtg
aaaccacgagtaattggtctgctcaggccactcaaggatgtaacagtgacagctggtgaa
acagccacttttgagtgtgagctctcctatgagggaatcacagtggagtggttcttgcat
ggacagaaactggaacccaatgataaggttgtcacacgtgctgaaggaagagtacacacg
cttactcttagagatgtcaagttaacagatgctggagaagtctcattgactgctaaggat
ttcaaaacacaagcaaatctttttgtaaaagaacctccagttgaatttactaaaccactt
gaggaccagacagtagaggaagaagccacagccgtactggagtgtgaagtatccagagag
aatgcaaaggtgaaatggttcaaggatggacaggaaattcacaaaacaaagaagcatgat
atcattgccgagggtcgggtcagaaaactcattattcatggctgcacattagatgatgct
agaacatatacctgtgatgctaaggatttcaagacttcctgcttcctgaatgtggaacct
cttcgtgttgactttacaaagccccttactgaccttgaagttaaagaaaaagagattgct
cggtttgaatgtgaaatttcccgcccgaatgtcaaggtacggtggtttaaggatggcgtt
gaaataagaaaaggcaaaaagtatgacataatctccaaaggtgcccagcgtattcttgtg
atcaacaaatgtttatttgaagatgaagcagaatatgcatgtgaagcaaaaacagctaga
acttcaggcatcctaacagttatagaggaagaagctgttttcaccaaaaatcttcccaat
attgaaataaatgaaactgaaactgtgaaattcatttgtgaagtctctaagcccagtgct
gaagtaacttggtttaaaggagataaagaattaccagaagttggtagatatgaacagatc
gctgatggccgaaagagaattctcataattcgtaatgcccgtcttgatgacgctggagaa
tacaactgtaggcttccaagtactcgctcaactggaaaactcaaagtacatgaacttgca
gcagaatttattactaaaccacaaaatgttgaagtactggaaggacaaaaagctgaattt
gtctgctcaatatccaaagatacctttgaagtacagtggctgaggggtaataaggaactt
gaggctggggataagtatgacatcatttcagatggcaaaaagagatttctcatcattaag
gactctattttagaagatgaaggaaagtattctgtcatggttagtggaatcaaagcaaca
gcacacttgaaagtgattgaaaaactcaggattataactccactaaaagatcaagtaatc
aaagagggagaagaacttgtttttaactgtgaggttaatacagaaggtgccaaagctaaa
tggtataaaaatgaggagccaatattcgacagtccaaaatctatcatggtccaaaaggat
ttagtttacacactcagaatcagagatgcacactttgcagatcaagccacctatacagtc
tctctatcaaatgccagaggggaacatgtcaagagctctgctacgttaacagtacatgag
gaggatctcaaaattgttgtccctcttgaagatattgagacaatggagaagaaatctgtc
acattctggtgcaaagtcaatcgcctcaatgtaacccttcagtggacaaagaatggcgag
gaagttacacttgacagacgcattctgtacaaagttgacaaatacaaacactcgcttatc
attaaagactgtgggtttatagacgaaggtgaatacactgtcactgctggacaagacaaa
tctgttgcagagctcatcatcacagaggcacctgcagacttcattgagcaccttcgtgac
cagactgtcactgaatttgatgatgctgtctttacctgccagctttccaaagagaaagca
agtgtaaaatggtatagaaatggacgagaaatcagagaaggcaaaaagtatctgtttgag
aaggatggaaatttacacagattaattataaaagactgtagactagaggatgaatgtgaa
tattcctgtggcgtagatgacaggaaatctagggcaagactttttgttgaagaaatccct
attgagatcatccgaccaccacaagatatttatgaagctcctggctctgatgtcatcttc
atggcagagttaaataaagatggcgtggaagtcaagtggttaagaaataacatgattata
gtccagggtgacaaacatcagatgatgagtgaaggaaaggtccatagactgcaggtgtgc
gagataaagcctcgtgaccaaggcgaatacagatttattgccaaagataaagaagctaga
gctaaacttgaattggctgctgccccaagaatcaagactggtgaccagaaccttgtggtt
gatgttgggaaacctttgaccatgattgttccatatgatgcctacccaaaagcagaagct
gagtgggtaaaagatgaggagagcctgcccacacaaacagttgatacaacagctgatagc
actaccttcaaaatttttgaagcaaagaaatcagataaaggaagatacaagattatactt
caaaacaaacatggcaaagctgaagcacacatcaatgtagatgtaattgatgttcctggt
cctgttagaaacttagaagtcactgaaacatatgatggtgaggttagcctggcctgggag
gaaccggaaagtgatggtggaagcaaaatcattggctatgtcgtagaaagacgtgatgtc
aaacgtaaaacatggattttggccactgaccatgctgaaagttgtgaatatacagttact
ggacttcagaggggaggagttgagtacctcttccgagtaagggccaaaaacagagtgggc
actggagaaccagtggaaacagacacacctgttgaagcaaagagcaaatttgatgttcca
ggtcctcctctgaatgtagaagttattgatgtgaacagatttggtgcttcacttacctgg
gagccaccagaatatgatggaggctctcccattactggctatattgttgaattgcgtgac
aaaggttcaatcaggtgggaacctgccatgaccactggagcacatgaattaggtgttacc
atgaccgatgttgtggaaaacaaagaatactacttcagaatcagagcacaaaatcagatt
ggagttggtaaaccaagtgctgctactcgagctgttaaaattatggatccaattgaaaaa
ccaagtcctcccattaacctcagtcattcagaccaaactaagtcatctgtgcagcttaca
tgggagcctcctctgaaagatggaggaagtccaataatgggttatattattgaaaggcga
gaagagggaacagacaactggatccgctgtaacccaagacttgtccctaatctgacttat
aaagtaactgggctgaaaccaggagccagttattactacagagtctctgcagaaaatgca
gctggtgtatcagatccagctgaggctattgggccactgactgcagatgatacatatgtt
ggacctacaatggacttaagtgcatttaaagatggactggaagttatcgtcccagagcca
ctcaagatccgtgttccaatcacaggctaccctgtgccaactgcaacgtggtctgttggt
gacaaaattttagaaaagggtgatcgtgtgaaaatagagacatctgcagcctttgcagaa
cttattatttctccaagtgaacgtccagacaaaggcatttataccttgaaattagaaaac
cctgtgtcatccatttcaggagaaattgatgttaatgtcattgctcgcccaagtgcacca
agagaactaaaagtgatagacatgagcaggaacacagtgcaattgacatgggaaccacca
gaaaatgatggaggaagtccagtgactggctatcttattgaaaaacgtgatataagccgg
aaaacatggaccaaagttctggataatgttgttgaccaagacttcactgtacccgatctc
atccaaggaaaagaatatttgttcagagtttcagcacgtaataaatgtggaccaggagag
cctgcatatattgatgaacctataaatatgtcagcaccaacaacggtgcctgatccacca
gagaatgttaaatggagagacccaacatctaaaagcatcttcctatcatgggatccacct
aagtatgatggtggatcacgcatcaagggttatctggtagaaaaatgccaacgtggtact
gacaagtgggagccctgtggtgagcctgttgctgaaacaaaaatggaagtaccaaaactt
aaagaaggtgaatggtactcataccgggttaaggctttgaataaacatggagcaagcaaa
ccaagcaagccaacagatgagatccaggctgtggatacaaaggaggccccagaaattttc
ctagatgtgaaacttctggctggactgactgtgaaagctggaactaaaattgagctacca
gctacagtaaaaggaaggcctgagcctcgaattacttggaccaaggctgataaaattctg
agacctgacgatagaattaagattgaaaccaaacccaaccattccacagtcatcattgca
gacagcaagagaagtgacagtggcacctatattattgaagctgtaaattccagtgggcgt
gctactgctgttgttgaagttaatgttttagataagcccggaccacccgctgcatttgat
atatcagatattacaaatgaatcctgtttcctgacatggaatcctcctcgagacgatggc
ggatctaaaatcacaaactatgttgttgagagaagagctacagacagtgaagtttggcac
aagatgtcatcaactattaaggggacaaacttcaaagcgacaaacttaatctctcagaaa
gaatacatcttccgagtcagtgctgaaaacatgtatggtgttggggagccggctgtacat
agccccatcattgctaaatattcatttgatccaccagggcctccaacaggtgtcacacct
tctgaagtcactaaggattctgtgaccttaacatggtgcgaaccagatgaagatggcggc
agtccaatcactggttattgggttgagagatacgatcctgatcacgacaagtggataaga
tgcaataagataccagtgaaagatacaacattcaaagttaaaggtcttatcaacaagaag
aagtacaagttccgtgtcttggcagagaatcttgcaggacctggcaaaccaagcaaagag
acagagccagtcctagtgaaggatcccattgatcccccatggccccctggcaagccaact
gtgaaagatgttgccaaaacatcattattccttcagtggacaaagccagaacatgatgga
ggtgcaaagattgagtcttatgtcattgagttactaaaaactggaacagatgaatgggta
agagtggcagaaggtgtccccttgactgaacatttcctcaagggacttatggagaaacaa
gaatactcattccgcgtaagagctgtgaacaaggctggggagagtgagcccagtgagccc
agtgaccctgtgttatgcaaagagagactgcaccctccttcaccacctcgatggcttgag
gttattaacattactaagaacactgctgatcttaaatggacagtaccagaaaaagatggg
ggttccccaattaccaactacattgttgaaaagagagatgtgagacggaaaggctggcaa
acagttgatacaacagtaaaagacatcaaatacacagtgactccactcactgaaggctct
ctctatgtgttccgtgtggctgccgaaaatgcagtgggacagagtgactattgtgaaatt
gaagattcagttctcgctaaagacaccttcactactcctggacctccatatgctcttaca
gtggttgaagtgaccaagagacatgttgacctaaaatgggaaccacctaagaatgatggt
ggcagaccaattcaaagatatgttattgaaaagaaagaaaaattaggcacacgctgggtg
aaagctggcaagacacctggacctgactgtcatttcagagtgactgatgttattgaaggt
acagaggtacagttccaggttcgtgcagaaaatgaagctggttgtggtcatccaagcgag
ccaactgaccttcttgctattttagaccctacaagccctccttcaccgcctctcgattta
catgtgacagatgcaagcagaaaacacatttccattgcatggaaaccaccagagaaaaat
ggtggcagtcctattattggatacaatgttgagctgtgtgaagcaggaacagaaaaatgg
atgcgagtcaattcgcgtccagtaaaagacttgaaatacaaagtggaagagggcattgtt
cctgacaaggaatatgtgctgagagtcagagctgtcaatgctattggagctagcgatcca
tcagacatctcagaaaatgttgttgttaaagattcagactgcaatcctaccgtcgaccta
aagactaaagacattattgttgttgaaggagagaagttaagtatcccggtacccttccga
gcggttccatcaccaaccattacatggcataaagatggcaaggaggttaaaataggggac
agaacaacaacgaagagtgactatacatcgacattgcttgaagtcacgaatagtgttcat
gctgatgcaggtgtttacactatcaccctggagaacaaactaggctctacaactggctca
gttaatgtcaaagtcataggtctgcctggacaatgcaaaaacattaaagcaagtgaagtg
actaaaaattcatgcaagatctcctgggaacctcctgactttgatggtggcactcccata
ttacattatgtcttggaacgtagagaagctggtcgaagaacatatattccagtgatgtct
ggtgagaataagctctcatggaatgtcaaggatcttataccaaatggtgaatattacttc
cgtgttaaagctgtcaataaaattggaggaggcgaatacactgaattaaggaacccagtc
attgctgaagatccaaagcagcgtccagatccacccattgatcttgaaattcacaatcca
acatcaaagtcagtaacacttacatggaagccaccgttgtatgatggaggctgcaagatt
atgggatatatcttagaaaagcttcctaagggtcaagacaagtgggaaaggtgcaatgac
catttggtacctgttttgacttacacagtaaaaggtcttgaggagggcaaggaataccag
ttccgtgctcgtgcagagaatgctgcaggtgtcagtgaaccttctcgtatcactccctta
gtgaaagctgttgatcccattgaggttccaaaagtcttccttgctgctaatctgcaggct
ggccttgaggtgaagtgtggtaatgaaattgcactggaagcacatatttcaggatcacca
tacccatctatcacttggttaagaaatgatgaaattattaggccagaggaaattaagaag
agagtaacaaagtttactaggagaaagaagggtgaagttgaagaagaggagccattttac
ctttcgctgacagaacgtttgaatattgacaaccacacacaaggagagtccttgctagcc
gttcgtgactcaatcagacgtgactatggcacatttacaatcagagttgaaaatgatcat
ggtgttgcaaaagcctcttgtgaagtaaacgtattagatacacctggacctcctatcaac
tttacatttgaagatgttagaaaacattctgttgtttgcaagtgggagccacctcttgat
gatggtggaagtgaaatcctgaactatgtcctggaaaagaaagacaactcaaaagctgaa
ataggttgggttactatcacttcaacactcaggcattgcaaataccatgtactaaaactg
attgaagaaaaggaatacctcttccgtgtaacagctgaaaataggttaggacctggacca
ccatgtgtttccaaacctctggtagcgaaagatccattcagtccaccagatgcccctgat
aagcctgatgtggtggatgttaccagtaatagtatgttagttaaatggaatgaaccaaaa
gacaatggtagccccatcttgggctattggattgaaaaacgtgaaattaatagtactcac
tgggctcgtgtcaacagaaacctcctgaatgtcttagaaataagagctgatgggcttttg
gaaggacttacctatatctttagagtgtgtgctgaaaatgcagctggccctggcaaattt
agtccaccttcagatcccaaaactgctcaggatccaatattgccacctggaccacccatt
ccaagtgttgttgatacaagctcaactgctattgagttagaatgggaacctccagcatac
aatggtggtggtgatatcactggttattttgtttacaaacaactggtgggcataaatgaa
tggtcacgctgcacagagaaatccattaagattagaaaatacactgttaaaggaattaga
gaaggtgctgactataaacttcgtgttactgctgttaatgcagctggggaaggaccacct
ggtgaaactgaacctgtgacagtttcagaacctcaagagcctcctcatgtggaattggat
gtttctgtcaaagcaggcattcagataatggctgggcaaactcttacaattcctgctact
gtcactgggcgccctacacctactattgtgtggactgtggaggaaggtgaactggataaa
gagcgggttgttattgaaaatgttggcaccaaatctgaactaactattaagaatgcactg
agaaaggaccatggaagatacatgattactgcaaccaatgagagtggctccaaatttgca
gcaaccagagtagaagtttttgatgttcctggaccagtgcttgatctaaaacctgtggtt
ataaacagaaagatgtgtctgcttaattggtctgatcctgaagatgatggaggaagtgat
atcattggtttccttattgaacgcaaagatgccaaaatgcacacatggagacaatgtata
gacactgagagatctaagtgtgatattacaggtcttgttgaaggacaggaatacatgttt
cgtgttatagccaagaataagtttggctgtggtccacctgttgacttaggaccaattctt
gcagttgatccattaggtcctccaacatcacccgagaggttcatgtacacagaaaggaca
aagtcaaccatcacacttgactggaagcctccccgtaatgatggcggcagtcctatcata
ggatacatcgttgataagagaagacatgactcagatgtatttgaaagagttaaccagaaa
ctctgtccaactacatctcttcttgtagaagatcttgctgagctgcacatgtatgaattc
cgtgtcaaagcagtcaatgctattggtgaaagtgaaccatcactaccacttaacgtagtt
atacaagatgatgaagtatctcccactgtcacattacgtctggctgtcagaggagacact
atcagagtgatggcaggagagnnnnnnnnnnatnggattgaatgggccaaaaatgaagtt
gtaattgaaaaaccattagatggacttaagataactaaaaaagaaataaatagatctgaa
gcaaaaacagaagtcagcatgcctgctgcagttagggacgataaaggcacttacacagtc
acagcttctaatcggcttggcacagcatatcgcaatgcttatgttgaagtgtatgatcgt
ccttctcctccaagaaaccttgcagtttctgacattaaagcagaatcatgctatttgacc
tgggatgctccccttgataatggtggaagtgaaattactcattacattattgaaaaacgc
gatgccagtaggaagaaatctgaatgggaggaagtctccgccacagtggttgacagacga
tttggggtgtggaaacttgcaacaaatggtgaataccaatttagagttagggcagtaaac
aaatatgggacaagtgatgagtgtctctcagagaaagtggtcattaaggatccctttggc
cttcctggacctcctggaaaaccaaaagttttagatcatactaggtcatcaatgctggtg
acttgggagcctcctttggacaatggtggatccccaatcactgggtattggctggagaag
agagaagtcggaggtgtctattggtcacgtgttaacagagctccagtaaccaaaccagta
atgaaagggttggaatttaatgtcctgcggttgattgaaggcgttgaataccagtttaga
gctatggcagtgaatattgttggaattggcccacctggtgaaccatcagatcctgcttta
gctgcagatcctatatttgtgcctggtgcaccatcatgcccagaagtcacagataaaacc
aaatcaactatagctttcaaatggaaacctccacaaaaagatggtggcagtcctataaaa
ggttatattgttgaaatgcaagaagaaggtagtcctgactggaagaaggtgaatgaccaa
gacaaactattcccaacttgtgaatgtgttgtacccaacttgaaagaacttagaaagtac
agatttagagtgaaagctgtaaatgctgctggggaatcagaaccaagtcttccaacatca
gaaatacccgtcaaggaaattctagaggaaccagaaatttttattgatattggagcacaa
gattttctctcggttcgttctggtacaacaattaaaatcccagccattataaagggacgc
ccagttccgaaaacatcttgggaatttgaaggagaagccaagaaagcaataaaggatgga
gtgaataatatacctgaagatgctcagctggaagtaacggataccacttcaataattact
atcccggaatgtaatagaggccattctggaagatacagtattacagcaaggaataaagca
ggacagaaaactgtaaatgtcagagttaatgtccttgatgtgccagggccaccaaaagac
ctaaaagtgagtgatataacaagatgtagttgcaaactttcatggaagatgccagacaat
gatggtggagatcgaatcaaaggttatgtaatagagaagaggactgttgaagggaaggcc
tggacaaaagttaatccagactgtggaagcacttccttcgttgtacctgatcttatagct
gggcagcagtatttcttccgtgtacgtgcagaaaaccgttttggtattgggccacctgca
gacacaatccaaaggaccacagcgagggatccaatccatcctcctgatccacctatcaaa
ctcaagattggtcttgtaactaagaacactgttagcctgacatggaaacctccaaagaat
gatggtggtgcccccgttacccattataatattngnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnntgatgtagaggaaacaaagttcacagttgaggacctgaaagaagga
gaagaatatgaattcagggtcaaagctgtaaatgaagcaggtccgagcagaccatctgcc
acagctggcccaataattgtcaaagaccaaacatgtccgccatcaattgaactcaaagaa
tttatcgaagctgaggagggaacagatattaacattgtagccaagataaagggtgtgcca
ttccccacattaacatggtttaaagctcatccaaagaaacctgatgacaaaataccagta
ctgtatgatcaacatgtcaataaggttgtgagtgaagatacttgcaccttattgatccaa
cagtctcgcaggagagacacaggcttgtattctttaaatgctgtaaacaattttggagct
gattcaaagacaatgaggctgaatgttcttggacttcctggaccaccagagggacccatt
aaatttgaatccatttcagctgatcagatgaccttgtcgtggcttcctcctaaagatgat
ggcggttccaaaattacaaactacgttattcaaaaaagagaagcgaatagaaggacatgg
gtacctgttaccaatgagcctaaagaatgcatcttcactgtacccaaattgctggaaggc
catgaatatatgttccgcatcatggcccaaaataaatttggcattggggagcctcttgac
agtgaaccacaaacagcaagaaaccttttcactgttcctggacaatgcgacaagccaaca
gttagcagcataacacatgacagcatgactgtcaactgggaggaaccagaatatgatggc
ggctctcctgtaacgggctactggctggagcgcaaagagaccactggaaagagatggaca
agggttaaccgagatcctatcaaacctatgacattaggcgtttcttacaaagtaactggt
ctcattgaaggttcagactatcagttccgtgtatttgctattaatgcagctggtgttggt
ccaccaagcatgccatctgacccagcaattgctagagaccctattggccctcctggtcca
ccttttccaaaagttactgactggactaagtcatctgttgatctggaatgggctccacca
ttaaaggatggtggttctaggatcactggttacatagttgaatataaagaggaaggaaag
gaagaatgggaaaaggtaaaagatagagaaataagaggaaccaagtttgttttggcagga
ttaaaagaaggaagtttttacagatttagagttagagcaataaatgctgctggcatcgga
gagcctggagaagttacagaagttattgaaatgaaggacagaattgtcccccctgatctt
cagttggatgctagtgtcagggacagaattgttgtgcatgccgggggagtgatccgaatt
atagcttatgtctcaggcaagccacctccaacagtcacctggagcagggaagaaagagct
ttgccagaagaagctaaaattgaagaaacagccatcagctcttctatggttattaagaac
tgcaagagaagtcaccaaggcctctatactctttttgccaaaaatgcaggtggagaacgg
aggaagactattattgttgaggttttagatgtaccagggccagttggcgttccattcctt
actgaaaacctaaccaatgactcttgcaaattgacatggttttctccagaggatgatggt
ggttctcctatcaccaactatattattgaaaagcgtgaagctgaccgtagagcttggacc
ccagtaacttatacagtcacaagacagaatgctactgttcaaggattgattgaaggcaag
ccatactttttccgaattgctcctgagaatattattggcatgggaccattcgttgagaca
acaaaagagattgtcatcagagaaccaatatctgtacctgagcgtccagaagatctggag
gtaaaagcaattaccaaggattccgttacattgacttggaacccacctaaatataatgga
ggttcagacataaccatgtatgtcctagaaagccgtcttattggaaaagagaaattccac
agaattacaaaggagaaaatgcttgataggaaatacactgttgagggattgaaagaaggt
gacacttacgaatatcgtgtgagtgcttgcaatattgtaggacaaggaaaaccatctttc
tgcacaaaaccaatcacatgcaaggatgaaattgctcctccaacacttgaacttgactgt
agagacaagcttattgttcgggttggtgaagctttcagcatgactggacattactcaggg
aagcctgccccaaaggtgacttggctaaaggatgaaattacagttaaagaagataagcgc
acaaagattcagactactccaacaaccctttgcttagggatattaaaatctatccgagaa
gattcaggcaaatattgtgtgatcgtggagaatagctctggatcaagaaaaggtctttgt
caagtcactgttgttgatcgccctcagcctccagtaggtccagttatttttgatgaagtt
cacaaagatcatatgttcatctcctggaagcctccacttgatgatggtggcagtgaaatt
acaaattatattattgagaagaaagatgcaaacagggatctctggatgccagtaacatct
gccaatgttaagacaacgtgcaaaattcctaaactgcttgaaggaagggagtatgttgtg
cgaatttatgctgaaaatctttatggcataagtgatcctctagtatctgatgaaatgaag
gccaaggatcgtttcagtgttcctgctgcaccagaacagccaatcattaaagatgttacc
aaagattctgccttagtaatttggaacagaccacatgatggaggcaagccaataactact
tatattttggaaaagaaggaaacaatgtctaatcgatggaccagagtcaccaaagatcca
attttcccagaaactcagttcagggtgcctgatctcctggaaggctgtgaatatgaattt
cgtgtatcagcacaaaatgaaattggtgttggtgatcctagtccaccatcaaagccaatc
ttcgctaaagatccaattgtcaaaccaagtccacctattaaccctgaagcagtggataaa
actaaaaactcagttgatttgtcttggcacccaccacgtcatgatggcaaaggaaagatc
attggctatctcgttgagtatcagaaagttggagatgaagactggaagaaggccaatctt
acagcagattcctgccctgaaacaaaatacaaagttactggtcttactgagggcttgatc
tacaagttcagagtcatggcagttaatgcagcaggtgaatcagaaccagcttatgttcct
gatccagtagaagtaaaggacaggcttgaacctccagagctgatacttgatgctaacatg
gcacgggaacaacttgtaaaagctggaaatacactaagacttagtgctgtaattaaagga
gttccattcccaaaagtgtcatggaaaaaggaaggccaagaagtttcacccaaagctgat
attgaggttacaggagttggcagtaagctagaaattcgtaatactgtccacgaagatggt
gggatttactctttgactgtcgagaatccagttggttcaaaaactgtctcagtaaaagtc
attgtactagataaacccggaccacctagaaatctgcaagtaagtgaagttagaagagat
tcttgctacctcacttggaaggaaccagaggacaatggtggttctgtcatcacaaactat
gtggtggaaaagaaagatgtagctgctgcccagtgggttccagtctccgcatcctcaaag
aaacacagtcatctggctaaacatcttatggaaggcactcagtatctcttccgtgttgct
gctgagaaccagtatggaagaggtccatatgttgagtgtctcaaaccaatcaaggctatg
gacccattacatactcctgggccaccaaagaatctgcaccatgtagatgttgacaaaaca
gaagtttcccttgtttggaacaggccagatcgtgatggtggtgctgaaatcactggatat
ttggtggagtatcaagaagaaggtgcagaagaatggattaagttcaagacagtacccatg
ctagagtgtgttgttactggtctaaagcaaggaaagacttacaaattccgtgtgaaagca
cagaatatcgtgggtcttagtcttccagatacaacaataccaatagagtgtcaagaaaaa
ctagtacctccatatgtggaactagatgtgaagttaattgaaggtcttgttgttaaagct
ggtagcacagtaagacttcctgcaatcatgagaggtgtacctgtgcccactgcaaaatgg
gtaactgatggcaatgaaattaaaacagaaggcaactacaaaattgaaactgacgattat
tcaacagtacttactattaaagagtgtgcaagaaaagatactggagaatatcttctcact
gtatctaatgcagctggcagcaaaactgttagtcttcatcttacagttttggatgttcct
ggtccaccaactggccccattaatattcttgaagtcacaccagaatacatggttatttcc
tggcgtcctcctaaagatgatggtggaagcccagtactaaactacattgttgagaagcaa
gaatccaagaaagaaacttggggagttgcctgttctggaatccagcacacaaaacttaag
gttccacgcctacagaaaggttgtgaatatattttcagagttcgtgcagagaataagata
ggcattggtgcaccacttgattcaataccaacaattgctaaacatatgtttgatccacca
tctccacctggtaaaccagtggtttcagatattacagaaaatgctgcaacagtgtcttgg
accataccaaaatctgatggtggaagtccaattactggatacattcttgaacgtcgtgaa
atatctggcaaatgggtacgtgtcaacaagacaccagtgcttgaactgaagttaagagcc
accggtctctttgagggcaatacatatgaattccgagcttttgcagaaaacatggttggc
ataagcaaaccatccccaatttctgatccaataaaaatttcacgtcctatcagaccacct
ggacctcccattaatccaaaactaaaggacaagaccagagaaacagctgacctggtatgg
acaaagcctctaaaagatggtggcagccctattttgggatatgttgtggaatgccagaaa
acaggaactacacaatggaacaggattaataaagatgaactcattccacagtgcgccttt
agggtacctgggctaattgaaggaaatgaatatagattccgtataaaagctgctaacatt
gttggagaaggagagccaagggaactaccagaaactgttcttgtaaaggatattctttct
cctccagaaatagacctggatgttacctgtcgtgacttaatcactgtcagagttggccaa
acaatccatattactggtagagtaaaaggcagaccagatcctgacataacatggtctaag
gatggcaaagtattagtccaagacaagcgtgttgagatggttcgtgaattccctcgtatt
gaactccaggtgaaagaagccactagagatgatcatggcaaatacatcattgccgcaaag
aacagcagtggacatgctcaagcctttgcccttgttaatgtacttgacagacctggacca
tgccagaacttgaagataagctatgttacaaaagattcttgtattgtgacttgggaaaac
ccaatagataatggaggctcagaaattacaaattacatagcagagtatcgccagccaaat
caaagaggatggtcaattgtctcttctgatataagcaaacgattagtaaaggcaaatctc
atagaaaaccatgaatacttcttcagggtttgtgctgagaacaaagtaggcccaggtcct
gtcactgagaccaagactcctatccttgccattaatcctgttgatagacctggtccacca
gaaaaccttcacattgcagaaacaggaaagacatttgtctatctgaaatggagaagacca
gattacgatggtggaagccccaatttatcttaccacgttgaaagaaaactaaaggattca
gatgaatgggaaagggtgcacaagggcagtattaaggaaacacactatatggttgataaa
tgcattgaaaataaaatatatcaattcagagttcagaccaagaatgagggaggtgaaagt
gactgggtgaagacaagtgaagttgttgtgaaggaagaattgcagaaaccagtccttgat
ctgaagttaagtggtgtgctaactgtaaaagcaggtgactcaattagacttgaggcagga
cttcgaggaaagccacaaccagaagtagtatgggcaaaggacaaagatgctacagattta
accagatctccaagagttacaattgaaacaacttctaatgcatctaaatttgttcttacc
aaatcgaagcgtagcgatggtggtaaatatgtgattactgcaactaatccagctggtagt
tttgtagcttatgctactgttaatgttttggataaacccggtcctgtaagaaatttgaag
atctctgacatttccagtgatagatgtactatcaactgggacccacctgaagatgatgga
ggttgtgaaatacagaactacatcttagaaaaatgtgaaagcaagcgtatggtttggtct
acatattctgctgttattctaacaaactatgcacatgtgacacgcctcatagaaggcaat
gaatatattttcaggattcgtgcagagaataagatgggcactggccctccaacagaaaca
aaaccaattattgcaaaaacaaagtatgatagacctggccgtcctgatcccccagatgtc
actaaagtcagcaaagaggagatgactgtagtttggaacccaccagaatatgatggtggc
aaatcaattacaggatacatactggaaaagaaagaaaagcgatcattaagatgggttcct
gttactaagagtgcaatcccagagagacgcaagaaggttacagatctcattccagtacat
gaataccaattccgtgtaaaagctgaaaatgaaattggtcttggggaaccaagcttgcca
tcaagaccagtaatggcaaaagacccaatagaacctcctggtcctccaactaatttgaag
gtggttgacagcacaaaaaattctatcactcttggatggggaaaaccagtctatgatggt
ggtgcaccaattattggatatgttgtggaaatgagaccaaaagttgaaagtgcagctcct
gatgcaggctggaaacaatgcagtgttgctgcacaagttattcatacagaatttacagtt
agcagcctggatgaaaaacaactatatgagtttcgggtttgtgcccaaaaccaggttggc
attggccgaccagctgaactgaaggaagctgtgtctcctaaagaaatacttgaatctcct
gagattgatttggatgcaagcctaagaaaattagtcacagtcagagctggatgccccatt
agactttttggcattgttagagggcgaccagcacctaaagtcacgtggaggagagtggga
attgataatgtggtcagaaaaggacaagttgacctcgttgacactatggccttccttgtc
atccccaattctacacgtgatgattcaggaaaatattctttgacagttgttaacccagct
ggagaaaaagccgtatttgtgaatgtcagagtacttgatactcctggacctgtggctgag
ttcagtgtttcagatgtcacaaaaatgtcatgtcagctttcatgggtacctcctgaaaat
gatggtggtagtccagtaactcattacatcctggagaaacgtgaggctgacagaaagacc
tggtcaacagtcattgcagatattaagaaaactagtttcaaagtagctaatcttatacct
ggaaatgaatacttctttagagtaactgcagtcaatgaatatggttcaggtgttccaaca
gacatgccaaaaccaatcttggcatcagatccactaagtgaacctgatccaccaagaaaa
cttgaagttactgaaattacaaagaacagtgcaactttaggctggttgccaccactgcgt
gatggaggctctaaaattgatggatatattattagctacaaagaagaagaacaacctgaa
gatcgatggacacaatattctattgtcaaagatctgaacattgttgtagtcggcctcaaa
gaaggaaagaaatacaagtttagagtggcagctagaaatgctgtaggagtaagtttaccc
agagaaactgaaggaatatttgaaattaaagaacagctcatgccacctaagatcctgatg
ccagatcatgttaatattaaagctgggcagaaactcagaattgaagcacatgtctatgga
aagcctcagccaaactgtaaatggatgaaaggagaacaagatgtatttctatcgagtcgt
ctggctgtgcataaagcagaaaaatcttcagttctcatcattaaggatgtgactaggaaa
gacagtgattactacactcttaaggcagaaaacagctctggtattgccactcagagaatc
agagttgtagttatggatgccccaggtccaccacagcctccatttgatatttctgacata
gatgcagatgcttgcacacttgcatggcatatgcctcttgaagatggtggcagcaacatt
acaaactatgtagttgaaaagtgtgatgtaagccgaggagactggataacagttgtagct
tctgtcacaaagacaagctgcagagttggaaaattgaccccgggacaagagtacatgttc
cgtgttcgtgctgaaaatcgttttggcatttctgagccactcacatctgacaagatggtt
gcaaaattcccatttgatgttccaagtgaaccaaagaatgcccgtgttaccaaggtcaac
aaggactgtatttttgtggcgtggaacaaaccagacagtgatggaggcagtccgattact
ggttacctcatagagcgtaaagaaagaaatagtttgctgtgggtgaaggctaatgatacc
cttgtgcgttctacagaatatccttgtgcaggactaattgaaggtctcgagtatactttc
agaatttatgccttgaacaaagctggagcaagcaaacctagcaagccaactgattttgtt
tcagcacgatccccagttgatcctcctggtaaaccagaagtcactgatgtcactaagagc
acagtgtcacttgtatggacaagaccaaagcatgatggtggaagcaaaattattggctac
ttcgttgaagcttgcaaactacctggtgataagtggatacgatgcaattctattccacat
caaattcctctagaagaatacactgctacagatttggaagaaaatgctcaatatcaattt
agagcaattgccaagacagcgattaacattagctggccttctgagccttctgacccagtg
actattcaggcagaaaatgttcctcccagaatagatctagatgtatctatgaaatcattg
cttacagtaaaagctggaactaacgtttgtcttgaagctaatgtgtatggcaaacctatg
ccaacaattacttggaaaaaagaaggagaagttttaaaaccagctgaaggcattaaaatc
accactaagagaaacctgtcgactgtggagttgttcagtgttaacaggaagcagacagga
gactatactattacagctgaaaatgcaagtggttccaaatcagccaccattaagcttaaa
gtacttgataagccgggtcctcctgcctcagttaaaatcaccagtatgtatgcagatcgt
gcaatgctttcttgggagccacctcttgaagatggaggttcagaaattactaactatatt
gttgacaagcgtgaaacaagcagaccaaattgggcccaagtcactgccaatgtaccaatt
acgagctgcagtgtagaaaaattgatagaaggacatgaataccagttccgcatatgtgct
gaaaacaaatatggtgttggagagcctatcttcactgagccaacaactgctaaaaatcca
tacaatgtacctgggccttgtgatccacctgtgattagtaatattacaaaggactttatg
actgtgagctggaagccaccagctgatgatggtggggcccctgtgactggatatatactt
gaaaaacgtgaaactaaggctgctaattggacaaaagtaaacaggaagcctgtcatagag
agaactgtaaaggccactggactccaagaaggaacagagtatgagtacagagtgacagca
ctgaataaggctggaccaggcaaacctagtggaccatctaaggcagcatatgcccgtgat
cctcaatatcctcctggccctcctgccttcccaaaagtggttgacacaacccgtaattct
ataagcctgtcttggagtaaaccagcatatgatggtggaagccccattattggttattta
gttgaagtaaaaagagctgacacagataactgggtcagatgcaatctgccaaaaaaccta
caggatacccgttatgtggtaactggactgtcagagaatacagagtatcaattccgaatt
tatgctgtcaataagattggatacagtgacccaagtgatgtgcctgacaaacaccttgcc
aaagacattttaatcccacctgagggagatcttgatgcagaactgagaaaagtacttata
ctgcgtgctggagtcacaatgaggatttatgtgccagtaagaggacgtccacctccaaag
attagttggtctaaagtgaatgccaacataagagacaggaaagggctagatatcaagtca
actgattttgataccttcctacgctgtgaaaatgtaaacaaatatgatgctggaaaatat
gtgttgactctggagaacagcagtggcaaaaaatcatataccatggttgtgaaagtactt
gatactcctgggcctcctattaatctgactgtaaaagaagcatctaaggattccgccttt
atttcatgggagcctcctctaattgatggtggcagtccagtcacaaactatattgttgaa
aaacgagacgcagaaagaaaatcatggtccacagtttcaacagaatgcccaaagacaagt
ttcaggacaactaatttagaggaagggaaatcgtactttttcagggtgctagctgaaaat
gaatatggcattggcgaaccttgtgaaactcgggatgctgttaaagcttctgaaacaccc
ggcccagttgttgacctaaaagctttggctataacaaagtcatcctgcaatctagcctgg
aaaaagcctttcagtgatggtggaagccgtattattgcatatactgttgaagttatgaca
gctgatgattcatggcaagaagttatgaggtcaaagaacctccagttttcaacaaaagat
ttgacagaaggaaaggagtatactttcagagtacgagcgcagaatgatgctggatatgga
acaccaagtgagattacagttgtggcaagagatgatgttgtggcaccagatcttgattta
agagctctacctgatttgtgctatttagctaaagaaggtagcagtttccgtcttaaaatc
ccaattaaaggaaaacctgccccaactgtcacatggaagaaaggtgaagacaaggtactc
actgagactggaagagttgcctttgaagctacagcagtcaacaccactcttttggtacgt
gactgccagaaagatgatgctggaaaatacacgatcactctgaagaacagtgctggcagt
aaggaaggcactatttccataaaagttgttggcaaacctggtattccaacaggaccggtg
aaatttgaagaagttacagcagatgctataaccttaaaatggggacctccaaaagatgat
ggtggttcagaaatcgctaattatatcatagagaagagagataatataaacaataaatgg
gtgacatgtgcttctgctgtccagaaaactacatttagagtttcaagacttcatgaagga
aatgaatatactttcaggatcagtgctgaaaataaatatggagtaggagaaggtcttaaa
tctgaccccgtggttgcaagacatccatttgatgtaccagatgctcctccaccacccaaa
attgttgaggttaggcatgattctgcatctctaacttggactgatccaaagaaaactggt
ggctcaccaatcacaggttatcaccttgaatttaaagaaagaaatagccttctatggaag
agagctaacaagactccattaaggatgaaagacttcagagtaacagggttaactgaagga
ttagaatatgaattcagagtgatggcaatcaacctagcaggagtaggtaaaccaagcctg
ccatctgaaccaattgtggcacttgatcccattgatccgcctgggaaacctgaagttatc
aatataactaggaactcagtaacgctcatttggacagaaccgaagtatgatggtggacat
aagttaattggctacatagttgaaaaacgtgacctgccttcgaaatcttggacaaaagct
aatcatgtgaatgttccagactgtgcatttactgtaactgaccttattgaaggtgggaag
tatgagttcagaattagagcaaagaacactgccggtgctatcagtcctccatcagaatct
acgggaaccataatatgcaaggatgaatatgaggcaccaagtattgttattgatcctaca
ttgaaagaaggcttgactgttaaagcaggagataccattacagtttctgctattagcatc
cgtggcaagccacttccaacttcagtatggtccaaagcaggaaaagactttaagccttca
gatcttgtacacattgaagcaactccaacttcctccacacttagtgtcaaatatgcagcc
aggaaagattccggtgaatacacaatcactgcaaacaatccttttggaactaaacaggag
catgtgcatgtgaaagttttagatgtacctggacccccggggcctattgaggtcagcaac
gtttcagctgaaaaagccactcttacatggtcacctcctgcggaagatggtggatcaccc
atcaagtcttatgtacttgaaaagagagaaaccagtcgactcctgtggaccttaattgct
gaaaatattgaaacttgcaggcatgttgttagcaaactcattcaaggaaatgaatatatc
ttccgtgtctcagctgtgaaccagtatggcaagggtgagccagtacagtcagaaccagtt
aaaatggtggatagatttggtcccccaggtcctcctggaaaaccagaagtaacaaatgtg
actaaaaatagtgcaactgttggctggaaaaggccagttgatgatggtggtagtgagatc
acaggctactatgtggaaaggaaagaaaagaaaggtttgagatgggtcagagtaacgaag
aaaccagtttcagaccttagatgcaaagtgactggactcctggaaggaaatgaatatgaa
ttccgcgtcagtgcagaaaatagagcaggggttggaccaccaagtgatgcttcaaaccca
gtgctaattaaagatgttgcctatcctccgggtccaccttcaaacccacaagttactgat
actacaaaaaccagtgcatctttatcatggggcaagcctcattacgatggtggacttgac
atcattggctacatagtagagcatcaaaaggaaggggaaaaagaatgggtaaaagacaca
acaggaactgctttaagaatcactgaatttgttgttgctaatctccagccaggagccaaa
tataatttcagaatcactgccctcaatgctgtgggtgctggtgaaccagcacaaattcca
aacattgaaatcaaggatcgggaaatgattcctgattttgaattagatgctgagctgaga
agaacacttgttgttagagctggactgactattcggatatttgtgccaatcaaaggtcgt
ccaacacctgaagttacatggacaaaagatgatatcccacttaaaggacgtgccaacatt
gaaaatacagactcttttactcttctaattatgacagagtgtaataggtatgatgctgga
aaatacataatgacccttgaaaatgctgctggtaagaaaactggctttgtaaatgtaaaa
gtcttggatacaccaggaccaccaataaatctcaagcctagggaaataactaaagacagc
atcaccctgcactgggatatgcctctgttagatggtggctcacgaataacaaattatatt
gttgaaaaacgtgaagcaacacgaaaggcatattcaacagtcagcaccaactgtcagaaa
tgttcccttaggattccaaatttggttgaaggatgtgaatattacttcagagtgctggct
gaaaatgagtttgggattggtgaaccagcagaaactacagatcctgtaagagcctctgaa
gcaccatcgccacctgagagcctcaatattatggatataacaaagagcacagtcagcctt
gcttggccaaagccaatacatgatggaggtagcaggatcactggttatataattgaagca
cagaaaaaaggttccactcaatggacacacatcacaactgtgaaaacattagattgtgta
gtgaagaatctaactgaaaatgaggaatatactttccaagttatggcagttaatagtgct
ggaagaagtgatccaagagagagcagaccagttgttgttaaagagcaactgatgcttcct
gaatttgacctccgtggaatttaccagaaattggtcattgccagagctggtgacaatatc
aaaattgagatccctgtacttggtcgtccaagaccagttgtgacatggaaaaaagaagac
cggctgattaaacaaacacaacgggtaaactttgaaaacactgcaactgcaaccatacta
aacatcaatgaatgcacaagaaatgatagtggtcgctatcccctgtcagctaaaaatatt
gttggagaagttagcgatgtaatcactgtccaggttcatgatattcctggccctcctact
ggaccaattaaatttgatgaagtttcatctgactttgtaattttctcatgggaacctcca
gagaatgatggaggggtaccaataagtaactatgttgtagaaatgcgtcagactgacagt
accacgtggactgagttagcaacgactgttatacgtaccatgtttaaagctactcatctc
actactggagtcgagtatcagttccgtgttaaagctcaaaatagatatggaacaggtcca
gccatctcttcagaacctgtaatagccaactatccatttaagcttcctgggcctccaggt
actcctcaggtgattgcagtcaccaaagagtcaatgaccattacctggaatgagcctgtt
actgatggtggaagtccaattatgggatatcatattgaaagaaaagaacgaaatagcatt
ctttggcagactgtaagtaaagcattggtagtaggcaatatctttaaatcagctggactt
actgatggcattgcttatgaattccgtgtcatagcagaaaatatggctggcaaaggaaaa
ccaagcaaaccatctgatccaatgtttgctctggaccctatagatccacctggtaaacca
gtacctctcaacattacaagacatgcagtaacacttaagtggactaaaccagaatataat
ggaggttttaagataactggttacactgttgaaaagagagaccttcctaatggtcgttgg
ctaaaggctaactttagcaatatactggaaacagatttcactgtaagtggtttaacagaa
gatgctgcttatgaattccgtgtgattgccagaaatgctgctggagcagttagccagcca
tctgaaccatcagatgcaataacatgcagagatgatatagaagcaccaaggataatggtg
gatgccaaatacaaggatactttagtactgaaagcaggtgacgttttcagacttgaggct
gatgttgcaggtcgacctccaccaaccatgacatggacaaaaaatgaaaaagaactagaa
gacacagcaaaattagaaataaaaagagcagatttctctactgttgtgatcaacaaagat
tctaccagaagagatggtggtgcatatatacttactgcttctaatcctggaggctttgca
aagcatatcttcaatgtaaaagtacttgatagacctggtccccctgaaggacctttggct
gtgtctgaggttacaagtgaaaaatgtgtactgtcatggttaccaccactggacgatggc
ggagcgaagattgaccactatgtggttgaaaaacgagaaactagtagattggcatggaca
aacgtggcctctgaagttccagtaactaaactgaaggtcactaacctattacaaggcaat
gaatatgtgttccgtgttatggctgttaacaaatatggggttggcgaggtcctggaatca
gagcctgttcttgcagtaaatccatatgtgccacctgatccacccaaaacacctgacgtt
acagcaattacaaaagattctatgattgtctgttggggacgtcctgattcagatggtgga
agcccaataaccaattacattgtagaacgtcgtgacagagctggactacgctgggtgaaa
tgtaacaaacgggttcttacagacttacgctataaagtatctggactgacagaaggtcat
gagtatgaatatagaataatggctgaaaatgctgctggaattagtgaaccaagtcccacc
agtcaattctataaagcttgtgatactgtgtttaagcctggtccaccaggtaatcctcga
gtcttggacactagcaagtcctcaattacaatagcttggaataaaccaatatatgatggt
ggctcagaaatcacaggttatatggttgagatagcactgcctgaagaagatgaatggaaa
attgtgactccatcagcaggactgaaggctacttcctttaccatcacagatctcaaagaa
aaccaggaatataaaatccgaatatatgccatgaattctgaaggtattggagaacctgcc
cttgttcctggatcaccgaaggctgaagaaagaatgctacctccagagattgaactggat
gcagaactacgtaaagttgtcaatatcagagcctgctgtactttaagactctttgtccca
atcaaaggaagaccagcacctgaagtgaaatggacaagagaatatggagagtctttagat
aaagctactattgaatcaacaagctcttatactctacttactgttggaaatgtaaataga
tttgatagtggcaagtatatattgacaatagaaaatagttcaggcagtaaatcagcattt
gtaaatgtcagggttctcgatacacctggagcaccacaagatttgaaaataaaagaagtg
tcaaaatcatctgttacacttacatgggagcctcctctcatagatggaggttcaaaaata
aaaaattatattgttgaaaaacgtgagtcaacaagaaaagcttattcaactgataatgcc
aattgccacaagaccagctggaaattagacaacctgcaggaaggttgcaactattatttc
agagtccttgctgaaaatgagtatggaataggccttccagttgaaacgccagaatcggtg
aaagtgtcagaaaggccactacccccaggaaagataactttgttggatgtgacaagaaat
agtgtatccttgtcatgggaaaaacctgaacatgatggaggcagcagaattctgggttat
attgtagaaatgcaaagcaaaggcagtgaaaagtggacaacctgtgctacagtaaaagtt
actgaagccactataagtggactgatacaaggggaggaatattccttccgtgtttcagca
cagaatgaaaaaggtattagtgatcctcgtcaactgggcatacctatcgttgcaaaagat
cttttgattccaccagctttcaagctattgttcaccactttcagtgtcctagcaggagag
gaattaaaggttgatgtaccatttgttggtcgacccaaaccaactgtattatggcataaa
gacaatgtgccactaagacagactactagagtaaacgaggaaagttcagaaaacagcaca
ttgctaacaataaaagaagcctgcaaagatgatgttggatcatatttagtcaaacttaca
aattctgcaggtgaagctactgaaactcttaatattgttgttcttgataaaccagggcct
ccgactggaccagtaaagatagatgaagtaacagcagatagtattaccatttcctgggaa
ccaccaaaatatgatggtggcagctcaatcaacaattatattgtagaaaaacgggacact
tctactactgtatggcacattgtgtcagccactgttgccagaaccacaataaaagcatgt
agattaaaaactggaagtgaatatcaattcagaattgcagctgagaacagatatggaaag
agtacatatctcacatcagattctgttgtagcccaatatccattcaaacttcctggtcca
cctggcacaccttttatatcagctcgctcaaaagatagcatggtagtacactggcatgaa
ccagtaaatgatggaggtagcaagatcactggctaccatctagaacgcaaagaaagaaat
agcatcctctgggttaaactaaacaaaacagctattcctgacactaaatttaagacaact
ggtcttgaagaaggacttgaatatgagttcagagtttatgcagaaaatatagtgggtatt
ggaaaggcaagtaaagcatctgaatgttatgcagcacatgacccatgtgatcctccaggt
cgtccagaacctataattgtcacaaggaactcagtagcccttcagtggaagaaaccagaa
tatgatggtggaagcaaaatcacaggctacattgttgaaaagaaggagttaccagatggc
cgctggatgaaagcaagctttacaaatgtcattgagactcagtttacagtaacgggccta
gtggaaaatcagaggtatgagttccgtataatagcaagaaatgctgcaggtgttttcagt
gaaccatctgaaagctcaggagcaatcacagccaaagatgaagtagagcctcctcgtata
agtatggatccaaaatataaagaaacaattatagtaaatgctggtgagtcattcaagatt
gatgctgatgtttatggcaaaccattaccttccattcactggctaaaaggtgatcaggag
ttaacaaacacagctcatttggaaataaaaagcacagattttgcaacaagcctcagtgta
aaagaagctattcgtgtcgatagtggtcagtatgtattgctggcaaagaatgttgcaggt
gaaaaaacagcttctgttcatgtcaaagttctcgatagacctgggccacctgaaggacct
attgatataacaggagttggtgctgaaaaatgcatgttggcttggaaacccccactacag
gatggtggtagtaatatttcacactatattgtagaaagaagagaaaccagccgcttagtt
tggactgtagtggactctaatgtgcaaacccttagttgcaaagttacaaaacttttggaa
gggaatgaatatgtcttccgtatcatggctgtaaacaaatatggtgttggtgaacctctt
gaatctgaaccaataattgcaaagaacccatttgttgtgccgcttccaccaaatgcccca
gaagtctcagccattaccaaggattcaatgattgttgtgtgggaaagaccagcctcagat
ggtggtagtgaaattctgggctatgttcttgaaaaacgagataaagaaggcattcgctgg
acaagatgtaacaaacgtttggttagtgaactgcgatacagggttactggacttatagaa
aaccatgactatgaatacagagtctcagctgaaaatgctgctggtcttagtgaaccaagc
ctaccttccacttactataaggcttgtgatcctatttacaagcccggtccacctaataat
cccaaagcaatagatgtgacaagatcttcagttttcctttcatggggcaaaccaatctac
gatggtggcagtgaaatccaaggatacattgttgaaaaatgtgatgttagtgttggtgac
tggacaatttgtaccccccctactggaatcaagaaaacaaatatggaagtagaaaatgta
ttagaaaaacatgaatataaattccgaatctgtgctgttaacaaagctggagttggagag
catgctgatgttcctggctctattattgttgaagataaactggaagctccagaccttgat
cttgacctagacttaaggaaaattgtaaatgtgagagcaggtggttccttaagattattt
gttcctattagagggcggccaacccctgaagtaaaatggggtaaaatggatggtgagatc
agagaggcagcagttattgacattactagcagcttcacttcccttgttcttgacaatgtt
agcagatttgatagtggaaaatacactcttactttagaaaacagtagtggaacaaagtct
gcctttgtcagtgtaagagtattggacaccccaagtccacctgttaacctaaaaattaag
gagatcaccaaagactctgtttcactttcgtgggaacctcccttactggatgggggagct
aagataaaaaattacattgttgaaaagcgtgaagcaacaagaaaggcctatgcagctgtt
gtaacaaattgtcataagacctcatggaaagtagaccaacttcaggagggttgcaattac
tacttccgagtcactgctgagaatgaatttggaattggcctccctgcagaaaccattgac
ccaattaaagttgctgaagttcctcagcctccagggaaaataacagtggatgatgtcaca
agaaatagtgtatcgctaagctggtcaaaaccagaacatgatggtggtagcaaaatctta
caatatattgttgagatgcaagtaaagggcagtgacaaatggtcagaatgtgcacgtgta
aaagcacttgaagcactggttactaatctaacgcaaggagaagaatatctttttagagtg
atagcagtaaatgagaaaggcaggagtgatccacgatctcttgcagttccagtggttgcc
aaagaccttgttattgaaccagatgtaagacctgcattccacagttacaatgtccaggtg
ggacaagatctaaaaatagaaataccaatttctggtcggcctaagccaactgttacttgg
acaaaagatgatcaaccattaaagcagacaactagagttaacattagtgatttgcctaat
cttactgtactgaatattaaagaagcaaacaaagaggacagcggcatgtatggaatcaca
gttgctaatgttattggacaaaagtctgcatctgttgaaattataacactagacaaaccc
gatcctccaagagggcctgtaaaatttgatgatattagtgctgaaagcattacattatca
tggaatcctccattgtatacaggtggttgccaaattaccaactacattgttcataagaga
gatacaacaaccactgtatgggaaactgtttcagctgctgttgcaagaactaccctaaag
gtgactaaactgaaaactggttcagaatatcagtttagaatatttgctgaaaacaggtat
ggacagagcttcgccttggaatctgaacctgttgtagcccagtacccctataaagagcca
ggtcctcctggcacaccatttgtgacaacagtaacaaaagactctatggttgtacagtgg
catgaaccagttaatgatggtggaagtaaagttttgggttaccatctggagagaaaggaa
agaaacagcattttgtggacaaaaataaacaagaccattattcaagacacacattataag
acatctaaccttgaagaaaacattgaatatgaatttagggtttttgcagaaaatattgtt
ggtgtaggaaaagcaagcaaagtttcagagtgctatgtagcccgagacccttgtgatcct
ccaggatgccctgaagccataattgttaaaagaagctcaattactctacagtggaccaaa
ccagaatatgatggaggtagcaagattactggttatattgtagagaaacgtgacttacct
gatggtcgctggatgaaagctagcttcacaaatataattgaaactcaattcactgtaact
ggacttactgaagatcaaagatatgaatttagagtcattgcaaagaatgctgcaggggca
ataagcaaaccttctgatagtacaggaccaataacagcaaaagatgaagttgagcttcca
agaatctcaatggatccaaaatataaagatacagttgttgtaaatgctggagaagtgttc
agacttgaagcggatgttcatggaaagccactacctacaattaagtggttcaaaggagat
aaggaacttgaagaaactgctaggtgtgagataaagaacaccgatttcaaggcattagtt
attgtaaaagatgccatcagagttgatggtggacagtacattttacaagcctctaacgtt
gcaggaacaaagtccgtaccagtgaatgtaaaagtattggacagaccaggtccaccagga
ggtccagttcaggttactggaattacttctgaaaaatgttcgttgtcgtggaatcctcca
ctccatgatggcggtagtgacatttctcactacattgttgagaagagagaaaccagccgc
cttgcttggactgttgttgcttcagatgttgtagccacaatgttgaaagtaacaaaactt
ttggaaagtaatgagtatattttccgtataatggcagttaacaaatatggtgttggtgag
cctctagagtctgttccagtactgatgaaaaatccatttgtggttcctgatccaccaaag
gcactggaaattaccaacattgcaaaggattctatgactgtctgctggagtaggccagat
agtgatggaggcagtgaaattattggttacattgtagaaaagagagacagagctggcatc
agatggactaaatgtaataaacgtcgaattacagatttgcgattaagagtcactggacta
acagaagatcatgagtacgaattcagagtatctgctgaaaatgctgctggaattggtgaa
ccaagccaaccttctccttatgttaaagcttgtgatcctgtgttcaagcctggtccacca
actaatgctcacgttgtagatacaaccaaaaattcaattacacttgcttggggtaaacct
atttatgatggtggtagtgaaatccaaggatacattgtagagctatgtaaagcagatgaa
gaagaatggacagtagctactccacagacagggcttcgtgtcactcgatttgagattaga
aaacttgttgagcatcaggaatataaaatacgagtgtgtgcgctcaataaagtaggagta
ggagaggctgcatcagttcctggaactgttaaaccagaagacaaacttgatgctcctgaa
cttgatattgattcagaactaaggaagggaatattggttagagctggtggatctgctagg
attcacataccatttagaggacgaccagcacctgaaatcacatggtctcgggaagaagga
gaatttacagacagggttcaagttgaaaaaggcataaactacacaactctatccattgat
aactgtgatagaaatgatactggaaagtacattcttaagttagagaacagcagtggctct
aagtctgcatttgttacagtaaaagtccttgacacaccaggaccaccacaaaatttagta
gtaaaagatgttaagaaaaattatgtggtattatcctgggaactacctgctaatgacggt
ggtgcaaaaataaagaactatgtgattgacaaacgtgaatcaaccagaaaggcatatgca
aatgtgagtgctaaatgtggcaaaacaagctttaaagttgaaaaccttacagaaggagca
acttattacttcagagttatggctgaaaatgaatttggaattggcattccagctgaaact
gcagatgcagtgaaagcctcagagccacctttgcctcctgggaaaatcagtctcactgat
gtgactcacacaagtgcatcacttatgtgggaaaaacctgaacatgatggcggtagcaga
attttggggtacatagttgaaatgcagcctaaaggaatagaaaaatggagcgttgtcact
gaaaccaaagtgtgcaatgcagttgtatcaggtttgagttcaggtcaagaatatcagttc
cgtgtgattgcctacaatgaaaaaggcaaaagtgatcccagagcgcttgcaattcctgtg
atagctaaagatttgacaattgaaccaagtttcaagctgatgtttaatacttatagtgtt
caagctggagaagatcttaagatagaagtaccatttataggccgaccaacccctaagatt
acttggacaaaagatgaggaaccacttaaacagacaaccaggttaaacgttcatgacaca
ccaacatctactatcttacatattaaagaaagtaacaaggatgactttggaaaatataca
gtaacagcatcaaacgcggcaggcactgcaacggagcacttgagcataattgtgcttgaa
aagccaggccctccacgaggacctgtccgctttgatgaagttagcgcaaactttgttgta
ttatcatgggatgcaccagattataaaggaggctgccagatagccaactacattgtagag
aaacgtgatacaaccaccaccacctggcatatggtatcagcaactgttgcaagaacaaca
atcaaagtggcaaatcttaaaacaggttctgaataccagtttagaatttgtgctgaaaat
agatatggaaagagctctccactggattctaaaccagttgttgtacaatacccatataag
gaacctggagcacctggtactccatttgttacatcagcttccaaggaccatatgattgta
caatggaatgaaccagttaatgatggaggaagcaaggttcttggctaccatatagaacgt
aaagataaaaatagcattctttggacaaagttgaacaaggccctcattttggacacaaaa
tacaaaactgatggccttgaagaaggtcttgaatatgagttcagagtttctgctgaaaac
attgttggaattggtaaagttagcaaagtatctgaactatatgttgcccgtgatccatgt
gatccacctggccgcccagatcccattattattacaagaaattatgtcacactaaactgg
aaaaaaccagagtatgatggtggtagcaaaataactggatatattgtagaaaggaaggaa
ctacctgaaggtcgttggatgaaagccagctttacaaatgtactagacacagaatttaca
gtaactggtcttgtggaaaaccagagatatgaatttagagtaattgcaagaaatgcagct
ggttgcttgagtgaaccatctgaaagcacagggccaattactgctagagatgaaattgaa
gcaccaggagcttcattggatccaaaatacaaagatgtcattgtggttcatgctggagaa
acctttattctggaagctgacatccatggtaaacctgttcctgacatttcatggtcaaaa
gatgggaaagagcttgaagaaacaactgcaagaatggaaattaaatctacacttcagaga
acaactctcactgtcaaagactgtataagaattgatggaggtcactactcgcttaacctg
agcaatgtaggtggtacaaaatcaataccaataacagtaaaagtgcttgacaggccagga
cctccagagggtcctttgaaggttacaggtgtcactgcagaaaaatgttatttggcatgg
gctccacctttacatgatggtggttctggtatctcacattacatcattgagaaaagagag
acaagcagactttcctggacattagtggcatctgaagtgcaagctcttaaccacaaagta
accaagcttcttccaggcaatgaatatattttccgtgtgatggctgtgaataaatatgga
attggagaatcactggaatctgaacctgttgtggcttgtaatccatacaaacctccaggt
cccccttcagtgccagaagtttcagctatcacaaaagagtctatgattgtaacatggggt
cgtccagcagatgatggcggagctgagatagaaggttacatacttgaaaagcgagacaaa
gatggtattcgatggaccaagtgtcataagaaaaggttaacagatttgcggttgagagta
actggacttacagatgggcatttctatgaattcagagtttctgctgaaaatgcagctggt
gtaggtgagcctagtgagccatccattttctatcgtgcatgtgatgcaatatatccacct
ggaccaccaagtaatccaaaggtgacagacacctccagatcatcagtgtccctggcttgg
aataagcctatttatgatggtggtgctcccgtcaagggatatattgtggaagtaaaagaa
gctactgttgatgaatggattacctgcacaccaccaacaggactacaaggaaaacagttc
actgtaacaaaacttaaagagaacaatgaatacaatttccgtatctgtgccattaactcc
gaaggagtcggtgaacctgcagttatacctggtacagtcattgcagctgataaaatagaa
cctcctgaaattgaactagatgcagatctcagaaaagttgtcactgtacgtgcaagtggt
acattacgtctgtttgttacaatcaaaggcagaccagaacctgaagtcaaatgggaaaaa
gcagaaggtaccattagtgaccgtgctcagattgaggttaccagttcatatacaatgctg
gtcattgataatgtaaacagatttgacagtggtagatacaacctaactttagaaaacaat
agtggcaaaaaatcagcttttgttaatgtcagagtcttagattcccccagtgcacctgtt
aacttgacaatcagagaagttaagagagattcagtaacattagcctgggaaccacctctt
attgatggtggagctaaaattacaaactacataattgaaaagcgagaatccactagaaaa
gcatatgccactgttacaaataactgcactaaaaataccttcaaaattgatcaactacag
gaaggatgcatttactacttccgtgtcttggcagcaaatgaatatggggttggtttgcca
gcagaaacagctgaaccagttaaggtttctgaaccaccatatccacctggaaaagtaact
cttgtagatgtgacttgcaacactgctacaattacatgggaaaaaccagagagtgatggt
ggcagtaaaattactgcttatatggtggaaatgcaaactaaaggaagtgaaaaatggagc
acttgtacccaagttaagacactagaagcaacaataacaggcttaagtaagggagaggaa
tacactttcagagtgattgctgtcaatgaaaaagggaagagtgatccaagacaacttggt
gttccagttgttgcaaaagatattgaaattcagccttctgctgaacttcttttcaatact
ttcagtgttaaagctggagatgatcttaagattgatgtgccaattagaggaaggcctaca
ccaacagctagttggaggaaagatggacagcccttgagagaaacaactagagtaaatgtt
caaacatcaaagacttcaacattgctagccatcaaggaagcatcaaaggaagatgtggga
aattatgaattatgcatttccaacagtgctggatccacaacattttctatcactgtaatt
gttcttgacagaccaggacctccatgtgacgtacatattgatagtgttagtgcagataat
gtaactttatcttggaaacctccagaatatgatggtggctgccatattagcaattacatt
gtggagaaacgagaaactaccacaaccacatgggatgtagtgtctgcagcagtcgcaaga
acatcaattaaagcagtgcgtctaaccactggatctgaatatcagttccgcgtgtgtgca
gaaaaccggtatggtaggagcacgtatactgagtctccctctgttgttgctgagtatcca
tttaagccacctggtccacctggaactcctcaagtagtacatgcaactaaaactttcatg
actgtaagttggaacgaaccagtcaatgatggaggtagtaaagtacttggatatcatctt
gaaaggaaagaaagaagcagcattctttggacaaaagtaaacaaaagcctcataagtgat
acacaaatgaaagtcactggtcttgaagaagggttaatgtatgaataccgtgtgtatgct
gaaaatattgcaggaataggcaaatgcagtaaatcatgtgaaccagttgctgcaagagat
ccatgtgatcctcctggtcagccagaagttactaacattacaagaacatgtgtctcgttg
tcatggtccaaaccagaatacgatggtggagctaagatcacaggatatattattgagcgc
agagagctaccagatggccgttggttaaagtgcaatttcactaatatacaagaaactttc
tttgatgtaactggacttacagaagatcagagatatgaattccatgttattgcaaagaat
gctgctggactgtgtagtgagccatctgaatcaactggacctgtgaccgtaaaagatgat
attgatgctccaagaatcatgatggatgtcaaattcagggacactgttgttgttaaagct
ggagaggtccttaaaatcaatgctgatattgcagggcgaccttcacctgtgatttcatgg
gcaaaggatggcaaagagattgaggaaaaagcaagagttgaaatagtctcaacagatcac
tctactgcaataactgttaaggactgcattcggcgggattctggtcaatatgtattaaca
ctgcagaacgttgcaggaacaagatctttggctgttaactgcaaaatacttgatagaccc
ggcccatctgcagggccattagaaataactggcattactgctgaaaagtgtcacctgtcc
tggggaccgcctcaagaaaatggaggtgcagatattgattattatattgtagaaaaacgt
gagaccagtagaattgcatggacactttgtgaaggagagcttagaacaacatcctgtaaa
gtgacaaaactacttagaggaaatgaatacattttcagagtgatgggagttaataaatat
ggtgttggtgaagctttggaaagttatgcagtcaaggccctagatccatttacagttcca
aatccacctaaatctttagagataaccagtgtgaccaaggattccatgaccctgtgctgg
gcaaggcccgacagtgatggaggaaatgagatctctggatacataattgaaagacgtgag
aaaaatagtctacgatggattcgtgtaaacaaaaagccagtttatgatctaagagtgaag
tcattaggtcttcgagaaggatgtgaatatgaatatcgtgtttatgcagaaaatgctgct
ggtctcagtcttccaagtgacacttcaccattgattcgggcggaagatccagttttcata
ccatctcctccatctaaacctaaaattctggattcaacaagatcaaatataacaattgga
tggataaagccattatttgatggaggtgccccagttactggatacacagttgaatacaag
aaaactgatgaaactgactggtcaatagctattcaaaatttaagaggcacagagtacaca
gtaattgggctaacatcaggatctgaatatgtcttcagagtaagatctatcaacaaagtt
ggtgctagtgatccaagtgatatctcagaacctcaggtagcaaaggaaagagaagaagaa
cctgcttttgatattgacagtgaaatgcgaaagactttaattgtaaaggctggtgaatct
tttacaatgaccgtacctttcaggggaaaacctgtcccgaatgtaatgtggagtaaacca
gagacagatctccgtacacgagcatctattgattcttcagattgttgtacctcacttacc
attgagaaagcaacaagaaatgattctggaaagtatacattaacattacaaaatgtccta
agcacagctactttgaccttagttgtcaaagttcttgatacccctggacctccatctaat
attgctataaaagatgtaacaaaagaatctgcagtgttatcctgggatgttcctgagaat
gacggaggtgctgtggtgaagaactattacattgaaaaacgtgaggcaagcaagaaggct
tgggtcactgtaaccaacaattgccatcgcctttcttacaaagttaccagccttcaagaa
ggtgccatttactacttcagagtctctggagaaaatgaatttggtgttggagtacccact
gagaccaaagaaggagttaaaataacagaaaaaccaagcccaccagaaaagcttggagta
actggtgttactaaagacagcatttcattgtcgtggctgaaaccagaacatgatggtgga
agcagaattctgagctacctcattgaagctcttgaaaaaggacaacaaaaatgggttaaa
tgtgcagttgtaaagacaactcatcatgttgtccatggtctcaaagagaatgttgactac
ttcttcagagtgtctgcagaaaatcaagctggtctaagtgatcctaaagaaatcctgctc
cctgttacagtgagagaacaactagcatctcctgagattgacatgaagggcttcccacat
aacactgtgtatattagagcaggatcgaatctaaaggttgaaattccaatttctggaaaa
ccattgccaaagattacattatccagagatggtgttccattgaaagcaaccatgaggttt
aatacagaaaccacaccagaaagtatcatcattaaccttaaagaaagtatggctggcgat
gctggtagatatgacatcactgctgccaactccagtggaaccactaaatcattcattaac
attgtagtgctagacagaccaggtcctccagttggtcctgttgttgttagtgatatcaca
gaagacagcgtaactctcaaatggcagccaccgaataatgatggtggaagtcaagttacc
aactatattgtactgaaaagagaaacaagtactgctgcttggtctgaggtgtctgcaact
gttgcaagaagcattattaaaatcatgaagctaacaacaggagaagaataccaattccga
atcaaagctgaaaaccgctttggaatcagtgaccacattgattcacagtgtgtaactgtt
aaactcccatacacaacgcctggacaaccttccacaccatgggtcaccaatgtcacccga
gagagcatcactgttggatggcatgaaccagtcattaatggaggcagtgcagtcattgga
taccatttggaaatgaaagataggaacagcattttatggcagaaagctaacaagaccctt
attcgcacaactcactttaaagtaaccaccatcagcgctggacttatctatgaattcagg
gtttatgcagaaaatgcagctggcattggaaaagcaagccatccttctgatccagttctt
gcaattgatgctacagaacctccaagaaatgttcgtgtcacagatatttccaagacgtct
gtcagtctttcttggacaaaaccatcctttgatggtggcagcaagatcactggttatatt
gttgagaaacgtgatcttccaaatggcagatggacaaagggcagttttaccaatgtcatt
gagactcagtttactgtatcaggactaacccaacattctcaatatgaattccgtgtcttt
tctaagaatgctgttggttctattagcaatccatcagatgttttaggtcctatcacatgt
cttgatacatatggtgcacctgaaattgacatgcaaccagaatacacagaagtggtgaaa
tacaaagcaggttctgcagttaagctgaaacttggcatctcaggcaagccgattcctaca
attgaatggttcaaaaatgacaaagagatacaaaccagtgcacaagtatctattgaaaac
acaacagaatttgcatctattctcatcaaagatgcaactcgttttaacagcggaaactac
gaattaaaattaaagaatgccatgggttcagcatcagctcacattagagttcaaatactt
gacaaaccaggacctccaagtggacctatacagttcaaaaccatcactgctgaaaagatc
accataatgtgggaacctccagtagatgatggtggtgcaactgtaacacactacattgtt
gagaaacgagagacaagtcgggtagtatggtctttaatttccgaaaaactagaggaatgt
gtcgtcactaccacaaaactcatcaaaggaaatgagtatgtgttccgtgtccgaggtgtg
aacaagtttggaattggagagccactagaatctgaaccagcgatagctaaaaatgcattt
gttacacctggaccacctagtgtaccagaggtcactatgataactaagcattcaatgaca
gttgtctggaacaggccaactgtagacggaggtagtgaaataagtggatattaccttgag
aaacgtgacaagaagagtctgagctggttcaaggttgttaaagaaactatacgtgacacc
agacagaaagtaacaggactaactgaaaacagtgaatatcatttccgagtttgtgctgtt
aatgcagctggacaaggtccattctctgaaacttctgacttctacaaagctgcagatccc
attgacaaaccagggccaccagttaagctaaaggttgtggatactactaagacatctgtc
acccttggctggactaaacctgcctatgatggaggaagtgcaattaccagctatacagtg
gaaaagagagaaggagaacaagaagaatggactgtagtcagtgctaggggagaaatcaga
acaactgagtatgttgtatcccatcttcaacctgcagtcaattactacttccgtgtgtct
gctataaattgtgctgggcaaggagagcctattgaaatgacagaatctgtacaagctaaa
gatatactcgaggagccagagattgacctggatgttgctctcagaacctccattgtagct
aaagcaggtgaagatgtacagataatgattccattcaaagggagacctcctccaactgtg
atatggagaaagggtgaaaagaaccttggaactgatgaaagatacaacattcagaacaca
gaatcatccacattacttactatttctcaagttactcggaatgacacaggaaaatacgtt
ctcacaattgagaatggagttggtgaaccaaaatcttcatttgtcaatgttaaagtactt
gatacaccatcagcatgccagaaattacagcttaagcatgtatctcgtggcactgtgaca
ctagcatgggagccaccactcattaatggtggttctgaaataacaaattatgttattgaa
aaaagagatgccacaaagagagcctggtctactgttacaacaaagtgttctcatacatcg
tttaagataactaacctgtcagagaagactgcatacttcttccgagttcttgcagaaaat
gaaaatggattgggagaaccctgtgagacttcagaaccagtgaaacctgcagaagtacct
ggacctgtaaaggatctagccatgaaagattctacaaagacttctgttaccttacagtgg
agcaaacctgactttgatggtggcagcattatatcagactatgttattgaaaagaaaatt
attgaagaaaaagaatggtcacatgcaggcataagtaagacatgtgaatttgaagtagaa
aaacttaaggagctttctgtcatggaattcagggtatctgctaaaaacgaaaaaggattg
agtgatgctgttactgttggacccattacagtaaaagattttgtaataacacctgaagct
gacctttctgatatccctggaggacaaattactgtaagaattggccataatttgcacatt
gaattgccatataaaggtaaacccagaccaactatgagctggctcaaggacagcatccct
cttaaagaaagtgaacaagttcgcttcaagaaaactgaaaacaaaataagtttaagcatc
aagaatgtgaaaaaagagaatggtggcaaatacactttaattcttgataatacagtttgc
agaaagtcatttacaatcaccgttataactcttggtcctccatcaaaaccaaaaggacct
ataagactagatgaaatcaaagcagacagtgttattatgtcatgggatgtgccggaagat
gatggaggaggagaaatcacctgttacagcattgagaagagggaaacttcacaaaccaat
tggaagatggtgtgttctagtgttgctagaacaacattcaaagttcctaacttagttaaa
gacactgaatatcaatttagagttcgtgctgaaaatagatatggagtaagcccaccactt
atttcagcagatgttttagcaaaacaccagttcagaccaccaggtccaccaggtaaacct
gttgtgtacaacgtaacagctgatggaatgacaatatcttgggatgctccagtttatgat
ggaggttcagaaattactggataccatgttgaaaagaaagaacgaaatagcatcttatgg
cagaaagtcaatgtttcaccgatatctggtaaagaatacagaattactggattgattgag
ggcctggattaccagttccgtgcatatgctgaaaattctgctggtctaagcccagttagt
gagccaagcaaatttaccttggctgtttctccagtagatccacctggcactcctgattat
attgatatcactagggaaactgtcacccttaaatggactgcacctctgcatgatggaggt
agcaagattgtggcctacagcatcgagaaaaggcaaggaagtgatgatcgctggctcaga
tgcaattttacggatatcagtgagtgccaatatacagttacaggactcagcccgggtgac
cgatatgagttcagagtgattgcaagaaatgctgttggaacaatcagcccaccttcacaa
tcttcaggttatatcatgaccagagatgaatgtgttcctccaacaattgaattcagttct
gagcactttgaaggccttactgttaaggctggagagagcattagacttaaagtttttatc
agaggccgtccagtacctcaagtgacttggtttaagaatggaaaggagattgaaaagaaa
ctgaatattgaaataactaatgctattggatatagcactatctttgttagagatgccatt
cgggaccatcgtggcatatacacagtagaagccaagaatgcatcaggcaccaaacaagca
gacattacaatcagagtgcaagataccccaggaaaagttggtggaccaatacgatttaca
aatgttactggagagaagatgtctttatggtgggagcctccagctaatgatggctgtgct
gccattacccactatgtgattgaaaaacgtgaaaccagtagggttgcctgggcattaatt
gaagataactgtgaagcctgcagttacactgcacttaaattaataaagggcaacgaatac
cagttccgtgtctctgcagttaacaagtttggtgttggcagaccactggaatctgatcca
attgtggcacaaataccatacactgttcctgatgcacctggcacgccagaacctacgcat
gtaacaggagacagtatcacagtcacatgggctagaccaaaatctgatggaggaaatgaa
atcaaccagtatatcctggaaagaagagaaaaaaagagtgtccgctgggtcagagtgtcc
agtaagagacctattgctgagacaagacacagagtgactggcctgactgaaggcaatgaa
tatgaattccaggttatggctgaaaatgctgcaggagtaggacctccaagtgctgtctcc
aggctgattaaatgtagagagccagtaaacccgccaagtgctcctactattgtaaaagta
acagatacgtcaaagacaagtgtaagtttggaatggaccaagccagtttttgatggaggt
atggaaataattggctacatcattgaaatgtgcaaagctgatttaggagagtggcataaa
gtcaatgcagagacttgcattgctaccaaatatactgtcatcgacttagaggcaggtgaa
cgttataaattccgagtgagtgctgtcaatggtgcaggcaagggagaaagttgtgaagtt
cctgctacaatccaagcaactgacagactgtcttcacctgaaattgatattgatgcaaac
ttcaagcaaactcacattgttagagcaggtgcaactattcgtctgtttattgccttctta
ggcagacctgttcctactgccacgtggtctaaagcagactcaaaccttagccagcgtgct
aacattcacacaactgactcattcagtacgctgactgtagaaaactgcaatagaaatgat
gctggcaaatacatcttcactgtagaaaataacagtggcagcaaatctatagcatttact
gtcaaagtgctggacactcctggcccaccaggtcctattacctttaaggatgtgacaaga
ggctctattactttaatgtgggatgctcctgttttggatggaggtgcccgtatccatcac
tacattgtggaaaagcgggaagcaacccgtcgtagctggcaggtagtgagttcaaaatgt
aatcgtcaaatctttaaggtcactgatctcacagaaggtgtgccattctactaccgtgtt
tcagcagaaaatgaatatggtgtaggtgaaccatgtgaattaacagaaccagttgtagca
accgaggagcctgctccacctaagagactagatattattgatactaccaaatcttctgca
gtattagcttggctcaaacctgatcatgatggtggaagccgtatcactggatatcttcta
gaaatgaaacaaaagggatctgactattgggtagaggctggtcaaactaaacagcttact
ttcacggttgaaggtcttctggagaacaatgaatatgagttccgggtcaaggcaaagaat
gatgcaggctacagtgagcccagagaagctttctcttctgttattattaaagagccacag
attgaaccaacagcagatcttagtggaataacgagacagcttataacttgcaaagctgga
ggcacctttactattgatataccaattagtgggcgaccagctccaaaagtaacatggaaa
ctcgaagaaatgagactcaaggaaactgacagagtgactattaaaacaacaaaggataga
actacattgactgtaaaggacagcatgagaggtgactcgggcaaatattatttgacactt
gagaatacagctggagtaaaaacatttgctgtcacagtggttgtcatcggaagaccaggt
gtaatcactgggccaattgaagtatcatccatttctgctgaatcctgtgtattgtcatgg
aaagagcccgaagatgatggtggcactgatattacaaactacatagtggagaaacgagag
tctggtacaacagcatggcagctgataaattccagtgtgaaacgtactcagatcaaagtc
actcatctcactaaatacatggagtatgctttccgggtcagctcagaaaacagatttgga
gttagcaagcctgtggaatcagcatcaatagttgctgagcatccatttgtccctccaagt
ccacctaccaggccagaggtctattccgtgtctgccaatgccatggccattcgctgggag
gaaccatatcatgatggtggcagcaaagtcactggatactggattgaaaagaaagaacgc
aatactattctttgggtgaaggaaaacaatgtgccatgctttgagtgcaactacaaagtc
acaacactagtggaaggtctagaatatcaattcagagtatatgccctaaatgctgctggt
gtgagcaaagctagtgaagcttccagacctatagtggctcaaaacccagttgatccacca
ggaagaccagaggtaacagatgtcacaaggtctacagtgtcattgagctggtctccacca
ctttatgatggtggtagcaaaattattggatatattgtagaacggaaaccatacaatgaa
gctggagatggacgctggctgaaatgcaactataccattgtctcagaaacatgctttact
gtgacagctcttagtgaaggagaagaatatgaattccgtgtattagccaagaatgcagct
ggtgtaataagcagaggatctgaatctactggtgctgtaacttgcagagatgaatattcg
ccacccaaggctgagttggatgccagactgcaaggagaaattgtgaccataagggctgga
tctgatcttgttcttgatgcagctattggtggaaaaccagaaccaaaggtcttctggtcc
aaaggtgacaaagaactggacctgtgtgaaaagatctctctgcagtacaccagcaaacgg
gccattgccattatcaagtattgtgacagaagtgatagtggaaaatacacacttacagtt
aaaaatgccagtggaacaaagcaagtttcagtccttgtcaaagtgcttgattcacctggt
ccatgtgcgggcagaatcaatattagcagagtaacagaagagaagtgcactctggcctgg
aatgctccacatgaagatggaggtgcagaaatcacccattacattgtagaaagacgtgaa
accagcaggctcaactgggttattgttgaggccgaatgccaaacattatcatgtgtggtg
acaagacttattaaaaataatgaatacatcttccgtgtgagagctgtcaataaatatggg
ccaggtgttcccctggaaacagaagccattgttgctagaaactctttcactattccattg
caacccggtgcacctgaagcagtgggtattggcaaggaacacatcattattcagtggctg
cagccagaatcagatggtggcagtgagatcagcaactatcttgtagacaaacgtgaaaag
agaagtctacgctggacacgagtcaacagagattacatcgtttatgataccagactgaaa
gttacaggtctaatggagcatagtgaatatcagttccgtgtcactgcagtgaatgcggct
gggaacagtgagcctagcgatgcttctcaatctatcctgtgcaaggagccatcatacaca
cctgcacctccttcagcaccaagggttgtggatactactaggcacagcataagcttggca
tggacaaagcccatgtatgacggtggtgctgacctcttaggctatgtgcttgaaatgaaa
gaagaaggcactgaacagtggtacagaccacacactaccgccaccctaagaaatgctgaa
ttcacagtgactgctcttaaaacaagccagaaataccgtttcagagttgctgctacaaat
gtgaatggtatgagtgaattcagtgaatcatcagctgaaattgaacctgtggaaagaata
gaaataccagaacttgaacttgctgaagatctaaagaagactgtcactatcagagctggt
ggttctttgcgcctaatggtgtttgtatctggcagaccacctccaataattacatggagc
aaagagggcattgaccttgcaaatcggggtattatagacactacagagagctacactctg
cttattgtagataaagttaatcggtatgatgctggcaaatatgttattgaggctgaaaat
caatcaggaaagaaatcagcaactgtagccgtcaaagtatatgatacacctggcccatct
gccgctgtcagagttaaggaggtgtcgaaggattctgtgacaattacttgggaaattcct
actattgatggtggtgcaccagttaacaattatataattgaaaaacgtgaggcagccatg
agagcatacaagacagtaactaccaagtgcagcaaaacattttatagaattactggactt
atagaaggagctatgtactatttcagagtgctgccagaaaacatatatggtattggtgaa
ccttgtgaaacatctgatgcagtactggtttcagatgttcctatggtacctcagaaactg
gaggtggttgacatcactaaatcaactgtatctctagcatgggagaaaccacagcatgat
ggtggcagcagactgactggctatgttattgaagctagcaaagccggaacagaaaagtgg
atgaaggttgtgacactgaagcctaccgtctatgagcacacaatcatctctctaaatgaa
ggtgaacaatatttgttcagagtcagagcacaaaatcagaagggggtgtcagaaccaaga
gagattgtcacagcagtaattgtccatgaccaaaaagtgttacccacaattgatctggct
ggaataactcaaaagacagtttatgtgccagctggcagacccatcgagttagctattcca
attggtggcagaccaactccagctgtatcttggttctttgccggttctaagctaagagaa
tcagaacgcaccaaaattgaaattgatgctaaagtagctaaattaagtgtgcgtgaaacc
acaatacatgacacaggagagtacacacttgaactgaagaacgcggctggaacaactgct
gataccataaaagttatcattcttgacaaacctggaccaccaaccggacctatcagaact
gatgatattgattcaacgtctgttaccatttcctgggaacaaccagagctggatggtgga
gctgcattgagtggttatgtggtggaacagcgtgatgcacaccgccctggatggctacca
gtttccgaatctgtaacaaggacaatgtataaattcactagactcactgaaggttctgaa
tatgtgttccgtgtcgctgctaccaaccgctttggaattggatcctaccttcagtctgag
attatagaatgcaagagtaaaatcagccttcctggtcctcctgacactccacaagtgatt
gacatttctcgtgaaggtatgacactcacttggcatccaccagaagaggatggtgactca
cagatcactggttatattgtggaacgcaaagaagtcagagcagacagatgggtccgtgta
aataaaattccagtgactatgacacgttatcgctccactggactgattgaaggattagaa
tatgaacaccgtgtcactgctatcaatgccagaggcactggcaaaccaagccggccttcc
aaacctgttgttgctatggatccaattgctcccccaggtaaacctcaaaatccaagagtt
actgatactacaagaacatcagtgtccctagcctggagtgcaccagaagaggaaggaggt
tctaaagtcactggctacttgattgaaatgcaaaaggttgatcagtttgaatggaccaaa
tgtaataccactccgaccaagatacatgaatacaccttgacgcatctaccacaaggcgca
gaatatagattccgtgtgatggcttgtaatgctggcgggcctggagaacctgctgatgtg
ccaggaacagttaaagtgacagaaatgcttgaataccctgattgtgaacttgacgaaaaa
taccgggaaggtctgtttgtgagacaaggtggagtgatcaggcttacagtaccaattaag
ggtaaacccataccgatatgtaaatggactaaagaaggccatgacatcagcaagagagca
atgatagcaacttctgatacacacactgaacttgtgatcaaagatgcagaaagagaagac
tctggtacctttgatttggtacttgaaaacaaatgtgcaaagaaggttgtttatatacag
gtcagagtgattggcattccaaatccacctgaagggccactggagtatgatgatatacag
gctcgctctgtcagagtaagctggagacctcctactgatgatggtggcgcagatattatt
ggttacatcattgagaggcgagaagtacctaagactgcctggtacactgttgattccaga
gtcaggggaacatcattagttgtgaaagggctcaaagaaaatgtggagtatcacttccgt
gtttctgctgaaaaccagtttggtattagcaggtccataaaatctgaagaaccagttgta
ccaaagacacctttgaatcctccagagcctccaagcaatccaccagaagtacatgatgtc
acaaagagctctgttagcttattctggtccaggcctaaagatgatggtggttctcgtgtc
actggctactacgttgagcgtaaagagacatctacagagaaatgggtcagacataacaag
actcaaatcacgactacaatgttcacggtgacaggacttgttccagatgctgaatatcaa
ttccgcatcattgcacaaaatgacattggtgagagtgaaccaagccctgcttctgaacca
gtggtgtgcaaagatccatttgacaaaccaagtcaacctggagaaattgagatcacttct
atatctaaggacagcattactttagaatgggaacggcctgagtgtgatggtggaaaagag
atcctaggatactggattgaatatcgtcagtctggagagagcgcatggaaaaagtgcaat
aaagaacgtatcaaagacagacaattcaccatgggaggtttactggaggctacagaatat
gaattccgggtttttgcagaaaatgagaccggagtcagcagacctcgaagaacagccatg
acagtaaagactaaactaacatctggagaaacaccaggcataagacaagcaatgacggat
gttacaactaacctgggtgaagcagctcagttgacatgccagattgtagggaggcctctt
cctgacattaaatggtatcgtttcggcaaagaactgatacaaagccgaaaatacaaaatg
tcatctgatggacgcacccatactctgactgtactaacagaagaacaagatgatgaaggt
gtctacacttgcatggctaccaatgatgttggagaaattgaaacaagtggcaagctactc
ttgcaggctcctcctcagttccaccctggcttcccattgaaagagaaatattatgcaggt
gtgggtggcacccttcgcctccatattgtgtatattggtcgcccagtacctgctatcact
tggttccatgacaagaaacctttgagagattcagaaaatgttactattgagaacacagag
cattatactcatcttgtcattaagaatgtccatcataagacccacgctgggaagtacaaa
gtgcaactaagcaacatatttggaacagttgacactgtacttaatgtggaaatacaagat
aaaccagataaaccaacagggccaattgttgtggaagccctattgaaaaactctgtggta
atcagctggaagtctcctcaggatgatggaggtgctttgataacaaactatgtggtagag
aaacgtgaagccaaggaaggcacagagtggcaactggtatcttcaagcatttcaggcaca
acgtgcagaattgttaacctaactgaaaatgcaggctattatttccgtgtttctgctcag
aatacatatggcattagcgaagcactagaggtttcatcagttgttgttatcaaaagtcca
tttgaaaaaccaggacaaccaagtcaaccagtagcaactgctgttacaaaggactcttgt
gttgtgtcctggaaaccaccagctagtgatggaggtgcaaagatcagaaattactacctt
gagaaacgtgagaaaaaacaaaacaagtggattgcagtaacaacagaagaaattcacgaa
acagtctattctgtgacaagtcttgttgaaggtcttgaatatgaattccgcgtaaaatgt
gaaaatctaggtggtgaaagtgaatggagtgaagtatcacaaccaatcattccaaaatct
gatgtaccaatccaagcaccacatttcaaggaagaactaagaagcctgaatgtgaaattt
agagccactgcgacatttgtttgcaaagtcaccggtcatcctaaacctattgtgaaatgg
tttaagcagggtaaagagatcttgccagatggtgaaaaggttaagatacaagaatttaaa
ggtggatatcaccagcttgtcattacaaatgcaatggatgatgatgccactatctaccaa
gttcgagctaccaatcaaggaggatctgtgtctggtactgcctctttggatgttgaagtt
cctgctaagattcacttgccaaaaaatcttgaaggcatgggagctgttcacgctctccga
ggtgaagtggtcagcatcaagattccattcagtggcaaaccagatcctgtgattacatgg
cagaaaggacaagatctcattgataacaatggacattaccaagttattgttacaagatca
ttcacctccctagtttttccaaatggtgtggacagaaaagatgcaggtttctacattgtt
tgtgctaaaaacagatttggcattgatcaaaaaacagttgaattagatgtggctgatgta
cctgatccaccaaggggtctgaaagtaagtgacatttcaagggattcagtcaacttgagc
tggaatgctccagcaactgatggtggaagcagaatcacaaattacatcattgagaaatgt
gctactacagcagagagatggattcgtgttgcacaagctcgtgatactcgatacactgtg
gtaaacctatttggcaagacaagctaccagttccatgtaattgcagaaaataaatttgga
caaagtcagccttctgaacctacagaaccaattgtaacgaaggaagataagacaagaatg
ctgaactacgatgaagaagttgatgagaccagagaaatcaccacagtcaaagcatctcac
tcttctaccaaggaactctatgacaaatacatgattgctgaagaacttgggcgtgggcat
tttggaattgtccaccgttgtgttgagacagtttctaagaagaccttcctggccaagttt
gttaaagtaaaaggagctgaccaagttttagtaaagaaagaaatttccatcctaaacatt
gctaggcatagaaatatcttgtatcttcatgaatcatttgaaagcctagaagaattagtc
atgatctttgagttcatatctggagctgacatccttgaaagaattagtacagcttcattt
gaactgagtgaaagagaaatagtaaactatgtacgccaggtctgtggagcacttgaattt
ttacacaatcataacattggacattttgatatcaggccagagaatatcatttatattaca
agaagaagctccataattaaaattattgagtttggtcaagctagacagttgaagcctggt
gacagttttagacttcagtttacttctcctgaatattatggacctgaagtacatcaaaat
gatgtggtcagcacagccactgacatgtggtcacttggtgccctagtatatatacttcta
agtggtattaatccttttattgctgaaacaaaccaacaaactattgaaaatatcatgagt
gctgaatacaactttgatgatgaagcatttaaagatataagcattgaagccatggacttt
gttgatcgtctactagtaaaagagaggaagggtcgtatgactgctacagaagcacttagt
cattcatggctgaaacagaggacagaaaagatcagcactaaagtcatcaagacattaagg
cataggcgatactaccagaccctggtgaagaaagaatggaacatggttgtgtcagtagct
cgcatttcctgtggtggtgcagttagatctcagaaaggagttactgttgccaaagtaaaa
gttgcatcaattgacattggtcccatttctgggcagataatgcatgctgttgcagaagaa
ggagggcatgctaaatatatatgtaagattgaaaattatgatcagtcgacacaagtgact
tggtactttggtaccaggcaactggagaacaatgggaaatatgaaattagctaccatgaa
ggagtggcaaccatgtatgtcaaagacattactaaagcagatgatggtacctataggtgc
aaagtagtaaatgactatggtgaagatagttcctatgctgagctatttgtcacaggtatg
agagaagtttctgagtattatagatgcagaacagttaagaaagtgaaacgccgaatagat
actatgagacttctagagaggccaccagaatttactttgccgctgtataaccacactgcc
tatattggtgaaaatgtcaggtttggagtaactataactgtccacccagagcctcgagta
acatggttcaaatcaggtcagaaaatcaaaccaggcgatgacgataggaagtatactttt
gaatctgacaaaggtctctatcaacttaccatccataatcttactgaggatgatgatgct
gaatatactgttttagctcgcaacaaatatggtgaagacagctgtaaagctaagctgact
gtaattccacacccacctccagcagacactacattaagaccaatgttcaaaagattatta
gcaaatgcagagtgccaagaaggccatagtgtgtgctttgagataagggtatctggtata
ccaaaaccaaaattaaaatgggagaaagatggtcagcctctgtcctgtggtcccaacatt
gaagttgttcacgaaggcttggactattatgctttgcacatcagagatactttgccagaa
gatagtggttattatagagttactgctaccaacagtgctggatctgcaagttgtcaggct
tatctgaaagtagaacgcttgacatatgtcaagcatgaatacaagacagaagaagagcga
gaaaagcacgtacgaaaacaaattgacaagacactaagaatggcagaaatcctttctggg
actgaaactgttccactaacacaagctgcacaggaagcactaagagaagctgccatcctg
tataagccagcagtgagtactaagacagtcaaaggtgaatatgaaattcaaaagaaagaa
ataaaggaagaaaggagacttcgtatgccatatcaaataccagagcctcgcaggcatgta
cgtaccactcttgaggaagatcagagtattaaacagtttgtgcctatgtcagatatgaag
tggtacaagaaactgcgagaccagtatgaaatgccaggaaaactggacagaattgttcaa
aaacgatcaaagcgcattcgcctttctagatgggaacaattctatgtaatgccactccca
cgcatttctgatcagtataaacctaaatggcgcataccaaagctgtcacaagatgacctt
gaaactgtgagaccagcacgccgccgaacaccttctcctgattatgagctttattacaga
ccaagaaggcgatcactcagtgacctgtcagatgaggaattactcctacctactgctgac
tatttagccatgaagagaattgaagaggaaagactgcgtcttgaagaggaacttgagcta
ggcttttctgcttcaccaccaagcagaagtcctccacgttttgagctgtctgccctgcgt
tattcttcaataggggaacaggccagtacagaggaagccagaaaaagagagctgaggtac
tcaacctatcatatcccaacaaaaactgaaactggagcaagttatgcagaactacgtcaa
cgccatgacagggctgcctataggccaccaaaacaaaagcagagaataatggatgaaaga
gaggatgaagaattgcttcgtccagttatcacaactcagcgactttctgagtacaagagt
gagcttgagcgtatggcacaggaggaagagagcagaatgaggaggagacaaagagaaata
actgagattacatcagaagaagaagcagaaataaaaatggtggaacgtgttcaaagggaa
ttttcaccaccctcgaggctattaaggaggaggagatctctttctccaacttatattgaa
ttaatgcgcccagtatctgaattaattcatccccgttcacggcctgtagaagaaactgaa
aggagatcccctacaccagagagaactcgaccacgctcaccaagcccggtgactagtgaa
aggtcactttctcgattcgaaaggatggccagatttgatatcttctccaggtatgatgcc
atgaaatctgctttaaaaactcagaaaacaatggaaaggaaatacgaagttctgactcag
cagcctttcaccttggaccacacccctcgcatcactctgagaatgcgctctcatcgtgtg
ccatgtaatcataataccaggttcattctgaatgttcagtcaaaaccaacagctgaagtg
aaatggtaccataatggtattgaaattcaagagagcagtaagatacatttcactaataca
agtggtgtattaaccctggagattctcgactgccatattgatgacagtggaacatatcgt
gtagtatgcacaaactacaaaggagaatgttctgactatgctacattagatgttacagga
ggagattatactacctactcttcccggcgcagagatgaggaagtaccaagatccattttt
cctgacttgacaaagacggaagcttatgctgtttcctcatttaagaaaacatctgcaata
gaggctatttcttcagtaagagaagtcaaatcagaaatgacagagacaagagaatcactc
tcgtcatatgaacatcatgcttctgctgaaaagaaaatcacagcagctgaagaaaaatca
tttgaagaaagggcttcacacaagaagtttaagaccactcttccggcaacaatattaaca
aaaccacggtcaatcactgtctatgaaggagaaaccgcaagattttcttgtgacgttgat
ggtgaaccaacaccaacagtaacatggttacgtgcaggtcaagccattgtttcttccagg
cgcttccaagtcacacgaacacaatacaaatctacctttgagatttcttctgtccagaca
ttagatgaaggaagttacagtttggtggtggaaaactctgaaggaagacaggaagcacac
ttcactttgactgtacagagagcaaagattcctgaaaaagcaattttatcatctccaaga
gtcaaatctcctgagcctcgtgtgaagtctccagagccagttaaatcacctaaacgtgta
aaatcccccgaaccacctattgctcacccaaaagcaaaatcagcagcagaaggcaggaca
gctcctacagagaaagtgcaattaccagctgctactcctcccaagataactcagcaattg
aaagtggaagcttgtggagataaagtaaagttttcctgtgcagtggaaagcagtatctta
agtgtcagagaagtagcctggtataaagatggaaacaaactgaaagaagacagccatttc
atgtttcattattcagcagatggcacctatgaactcaaaatccataacctgaaagagtct
gatcaaggcgaatatacctgtgaaatcattggggaaggtggtatatctaaaactaacttc
cagtttgttggccaagtttttaaaagtatccattcccaaatgtcaagcatgactgaaaag
tctaaatcagctgagaaagaggctgaggcacttaaagtttctacccagaagaaatcagca
gttacagctcaagaaaaagcagtgatccaagaagaaattgtaaaaaagtcagtaatttct
gaagaagccaaaagatcacatgcagaaattaaagcttcttccactaaaatggctgtgtct
gaaggtcagaaatttactgtgaaagccaacattgatggtgcatctgaagttaaatgggta
ctgaatggaatggagctacctaattcagaagcttacagatatggtgtgtctggaagtgat
cacactttaaccatcaaaaaagctagtcataaagatgaaggaatacttacttgtgaaggg
aaaactgacgaaggcattgtcagatgccagtatgatatcacctttactactgagctctca
aatgcaccagccttcatcacacagcccaaatctcaaaatgttaatgaaggacaagatgta
ttgttgacttgtgaaatctctggggatccatctcctgaaattgaatggtttaagaataac
caaccaattgctatttcatccaaaatcagtgtaaatcgctccaatactatatattctctt
aatattctaaatgctgcagtgagtgacagcggaaaatacacagtcaaagcaaaaaattac
cacggacaatgctctgctacagcatccctgactgtactccctttaattgaagaacctcca
aaagaggtagtattgaggacaagtggtgatgcaagcatgcaggaaagtttctcttctcag
tcacttcaaatgtctgcttctaaacaagaggcttcattcagcagtagcagcatgactgaa
acgaaatttgcaagcatgtctgcccaaagcatgtcctcttccatgaaagaatcctttgta
gagatgagctccagcagtattatggggaaatctagtctgactcaactggagagttcaact
agtagcatgattaaatccagtttgagaggagtatcacccaaaattgaagctcttccatct
gatatcagcattgatgaaggaaaggttctcacagtatcttgtgctttttcgggtgaacct
gctcctgaagtaacatggtcctgcaaaggaagaaaaattactaatcaggaacagcaaggc
agattccatattgaaactagtgaagatctaaccacccttatcatcatggatgtccagaag
aatgatggcggactttatacgctgaatttaggaaatgaatttggcactgactctgccact
gtgaatattaatattcgatcaatttag

DBGET integrated database retrieval system