KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102452749Help
Entry
102452749         CDS       T02980                                 

Definition
(RefSeq) guanylate cyclase soluble subunit beta-2-like
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00230  Purine metabolism
pss01100  Metabolic pathways
pss04270  Vascular smooth muscle contraction
pss04540  Gap junction
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102452749
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102452749
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102452749
Enzymes [BR:pss01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     102452749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOB HNOBA
Motif
Other DBs
NCBI-GeneID: 102452749
NCBI-ProteinID: XP_014429995
Ensembl: ENSPSIG00000003324
Position
Unknown
AA seq 790 aa AA seqDB search
MMRSRQSKLMCSKTDSHCGCDETPTSMSSLLTPAQPTTPALHNQRTDSSTMYGFINTCLK
SLVIEKFGDETWEKLKTQAGVQDTFMTYMVYDDVITLRLIQEACKMLDLPEDAVLRLFGE
YFFTFCKMSGYDRMLRTLGGNLSEFIENLDALHSYLALSYQEMNAPSFRVEKRADGAMLL
HYYSDRRGLCHIVPGIIGSVARDFFNSEVTMEILTQREEKEHTGKKEHVIFLVLQKAERP
KRITRKTTNLKSGDSHKDNEALDTAFQKAKGNYFTLSCCPEKKSHWDIVRSVVKFGKGNL
SLAFVPVYPRRLWVEEKTFCNAFPFHIVFDEELRIKQAGVNIQKFVPGLRRPGSRVDKYF
SVIHPKVTFTIFTIRKFINSQFVLKVHREMLPDSWRNQPMLKLRGQMIWMESLRCMMYLC
SPKLRSLEELEERKMHISDMAQHDTTRDLILLNQQRLAEMELSNQLERKKEELRILSKNL
EAEKKKTETLLYAMLPKHVANLLKEGKKVEAGEFNSCTILFSDIVTFTNICSACEPIQIV
HMLNSMYSKFDRLTSVHDVYKVETIGDAYMVVGGVPVPTTNHAKRVANFALGMRTAAREV
MNPITGEPIQIRVGIHTGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGLPNKIHLSPTA
FRALHNQGFEIVERGEIEVKGKGKMTTYILRRNLYATENEIMGRTEKQHVRHMDEMEADA
LGNLASKTIAVMKYADSQQLLTSSSLAYEAEASLCNGESTKDDVEQQLSDQTRTQHFRVG
NAHSSLCVLL
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgctctagacagtcaaagctgatgtgttcaaaaacagactctcactgcgggtgt
gatgaaacaccaacaagcatgagcagcttacttactccggcacaacctacaacacctgcc
ctgcacaaccagcgaacagacagcagcacgatgtatggatttatcaacacctgcctgaaa
tctctagttatagagaaatttggtgatgagacatgggaaaaactcaaaacacaggcaggg
gtccaagacacctttatgacttacatggtgtatgatgatgttattactctgaggctgatc
caagaggcctgcaaaatgctggatttgccagaagatgcagtgctgagactttttggagaa
tatttctttaccttctgtaagatgtctggctacgatcgaatgctacggactttgggagga
aatctaagtgaatttattgagaatctagatgcccttcatagttaccttgccttgtcctac
caggaaatgaatgcaccatcatttcgtgtggaaaagagagcagatggggcaatgttactt
cactactattctgacaggagaggcctgtgtcatatagtcccaggtatcataggttctgtt
gccagagacttcttcaatagtgaagtgacaatggaaattctgactcaacgtgaagaaaaa
gagcacactgggaaaaaggagcatgtgatatttcttgttctgcagaaggctgaaaggcca
aagagaataaccagaaagacaacaaatctgaaaagtggagactcccacaaagataacgag
gcactagacacagcttttcaaaaagcgaaggggaactattttactctatcgtgctgccca
gaaaagaaatcccattgggatattgtgagaagcgttgtgaaatttgggaaagggaacttg
tcacttgcttttgtcccagtttatccaaggaggctttgggtggaagagaaaacattctgc
aatgcttttcctttccacatcgtgtttgatgaagaactaagaatcaagcaggcgggtgtg
aacattcaaaagtttgtgccaggactacgacgaccagggagcagagtagataaatacttc
agtgtcatccatccaaaagttaccttcaccattttcaccataaggaaatttatcaacagt
caatttgtcctcaaagtacatagagaaatgttgcccgactcctggagaaaccaacccatg
ctgaaactccgaggtcaaatgatctggatggaatccctacggtgcatgatgtacctgtgt
tcaccaaagctccgcagtttagaggagttggaggaaagaaaaatgcacatttccgacatg
gcacaacatgacacaacaagggacctcattctcctgaaccagcagcgtctggccgagatg
gagctgtccaaccagctagagcgaaagaaggaagagctcaggatcctttcaaagaacttg
gaggctgaaaagaagaaaacagaaaccttactgtatgccatgctgccgaaacatgtagcc
aatctgctcaaagagggaaaaaaggtggaagcaggggaatttaattcctgcacgatactc
ttcagtgatatagtgacattcacaaatatctgctcagcctgtgagcctatccaaatcgtt
cacatgctgaattcaatgtattcaaagtttgatcgattaaccagtgtccatgatgtttat
aaagttgaaacaataggtgatgcatacatggtagttggaggggtcccagtgcctactacc
aatcatgccaaaagagtggccaattttgcattgggtatgagaactgctgcccgagaggtg
atgaacccaatcactggagaacctattcagatcagagttgggattcacacaggaccagtt
ttggcgggagtggttggtgagaagatgcccagatattgcttgtttggagatactgtcaac
acagcttctcggatggaaagtcacggacttcctaataaaatccatctcagcccaacagca
ttcagagctctacacaatcaaggctttgaaatagtggaaaggggagaaattgaggtgaaa
ggcaaaggaaaaatgaccacttatattttgaggcggaatctctatgcaactgagaatgaa
atcatggggagaacagaaaagcagcacgtcagacacatggatgagatggaggcagatgct
ctgggaaatctagccagcaagactattgctgttatgaagtatgctgacagccagcagctg
ctcaccagcagcagccttgcatatgaagctgaagccagtctgtgtaatggagagagtaca
aaggatgatgtggaacagcagctttcagatcaaacaaggacacagcacttcagagtcggc
aatgcacattctagtttgtgtgttttgttgtaa

DBGET integrated database retrieval system