KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102453156
Entry
102453156         CDS       T02980                                 

Gene name
EPAS1
Definition
(RefSeq) endothelial PAS domain-containing protein 1
  KO
K09095  hypoxia-inducible factor 2 alpha
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pss03000]
    102453156 (EPAS1)
   04131 Membrane trafficking [BR:pss04131]
    102453156 (EPAS1)
Transcription factors [BR:pss03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102453156 (EPAS1)
Membrane trafficking [BR:pss04131]
 Autophagy
  Pexophagy
   Other pexophagy associated proteins
    102453156 (EPAS1)
SSDB
Motif
Pfam: PAS_3 PAS_11 HIF-1a_CTAD HIF-1 PAS PAS_9 PAS_4 Corona_I HLH HEXIM
Other DBs
NCBI-GeneID: 102453156
NCBI-ProteinID: XP_006125539
Ensembl: ENSPSIG00000012658
UniProt: K7G1Q7
Position
Unknown
AA seq 866 aa
MTADKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHNVSSHLDKASIMRLA
ISFLRTHKLLSSVCVDNESDLDIDQQIDNLYLKALEGFIAVVTQDGDMIFLSENINKYMG
LTQVELTGHSIFDFTHPCDHEEIRENLSLKTGPGFGKKNKEMSTDRDFFMRMKCTVTNRG
RTVNLKSATWKVLHCTGQVKVYNSCPSHSLCGYKEPLLTCLIIMCEPIQHPSNMDIPLDS
KTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCAKGQ
IVTGQYRMLAKHGGYVWLETQGTVIYNTRNLQPQCIVCVNYVLSEIEKNDIVFSMDQTES
LFKPHLLTMNTIFDNGVPVTEKSDFLFTKLKEEPEELAQLAPTPGDAIISLDFGTQKFEE
ASIYNKAAVLTLNKQWPGEVKSHTSQSETMTMPSFTMPQVAPGSSTPSASSNSSCSTPSS
PGDCYSSLDEDLKIEMIEKLFAMDTESKNQCNSQTDFNELDLETLAPYIPMDGEDFQLSP
ICQEERPLPENAPNTQQSLRSMSAIFQPLAPISQNEFLLEKYCQQISNKNTNPNHGPLSS
VFFNSSNSKSSLPPYHVRGSTPLASMVGRPGTQWPPDPPLQYVPTKWRLMDKYYGSLASS
SSGPPVHSPNVSLYKKRSLDSFEQHGIDINPARTALANSLKLKRQMDYEEQIFQQRTGAD
LSTINPSHLMWKRMKILKGENCSLVTEKKSLSTSVLTDEFIRNSQRGLSQPMNQLQQRQQ
QPSCGSPGENQKAAFSPQFYSSHYQNFNVQPIHKKSGVTSRLLGQSYEPYLLPELTRYDC
EVNVPVLGSSTLLQGSDLLRALDQAT
NT seq 2601 nt   +upstreamnt  +downstreamnt
atgaccgctgacaaggaaaagaaaaggagcagctcagaaaggaggaaggagaaatccaga
gatgcagcaaggtgcagaagaagcaaggagactgaagtattctatgaattagcccatgaa
ctgcccttgccccacaatgttagttcgcatctggacaaggcatccataatgcgtctggca
atcagtttcttacgcactcacaaactgttgtcttcagtatgtgttgacaatgagagtgac
ttggacatagaccaacagatagacaacttgtatctgaaagctttggagggatttattgct
gtagtgacacaggatggagacatgatctttttgtcagagaacatcaacaaatacatgggc
ctcacacaggtggaattaactggacacagcatatttgatttcactcacccatgtgaccat
gaggaaattcgagagaatctgagtttgaaaactggtccaggatttggaaagaaaaacaag
gagatgtccacagaccgtgacttcttcatgagaatgaaatgcactgttactaacagaggc
agaactgtaaacctcaaatctgccacatggaaggtcttgcattgcactgggcaagttaag
gtgtataactcttgcccttcgcacagcctgtgtgggtataaggagcctctcctcacctgc
cttataataatgtgtgaacccattcagcacccttcaaatatggatattccactggacagc
aagacattcttgagccgccatagcatggacatgaaatttacctactgtgatgacagaatt
actgaattgattggataccacccagaagagctactgggccgttctgcatatgaattctat
catgccttagattcagagaatatgactaaaagccatcagaacttgtgtgccaaaggtcaa
atagtaactggccagtaccgaatgcttgcaaagcatggtggatatgtatggctggagact
caaggaactgtcatttataatacacggaacctacaacctcagtgcattgtctgtgtcaac
tatgttctaagtgaaattgagaagaatgacattgtgttctcaatggaccagacggaatca
ctttttaagcctcacctgctgacaatgaacactatttttgataatggggtcccagtgact
gagaagagtgacttcttgttcacaaaactgaaggaagaacctgaggagcttgctcaattg
gcacccacacctggcgatgccattatttcattggattttgggacacagaagtttgaggaa
gcttctatctacaacaaagctgctgttttgactctaaacaaacagtggccaggggaagtg
aagtcccatacttcccaaagtgaaacgatgaccatgccatcatttacaatgccccaagtt
gcaccaggcagcagcactccaagtgcaagtagtaacagcagttgttcaacgccaagcagc
ccaggagactgttacagctccttagatgaagatcttaagattgagatgattgagaagctc
tttgctatggacactgagtcaaagaaccagtgcaactcccagactgatttcaatgagctg
gaccttgaaaccctggctccttacattcccatggatggtgaagatttccagctgagccca
atctgccaagaagagcgccctctccctgaaaatgcgccgaacacccagcagagtttaaga
agcatgagtgccattttccagccccttgctcctatctctcagaatgagttcctcttggag
aaatactgccaacagatttcaaataaaaacacaaatcctaatcatggacctctgtcatct
gtgttcttcaacagtagtaatagcaagtcatcactgccaccataccatgtgcgaggcagc
actccactggcttcaatggttggaagaccaggcacccagtggccacctgatccaccatta
cagtatgttcctactaagtggagactcatggataaatactatgggtccttagcaagttcc
tcatcggggccaccagttcactctcccaacgtgtccttatataagaaaaggtcactggac
agttttgagcaacatggcatagatataaaccctgcaagaactgctctcgccaacagtttg
aaactgaagcgacagatggattatgaggaacaaatatttcaacaacggacgggggcagat
ttgtcaacgattaacccgtctcatttaatgtggaaaaggatgaaaattctcaaaggtgaa
aattgttcattggttactgaaaagaagtccctcagcacaagtgtccttactgatgagttt
attcgtaactcacaaaggggtctgagccaaccaatgaaccagctgcagcaacgacagcag
caaccctcttgtggaagccctggtgaaaatcagaaagcagcattctctcctcagttttac
agttcccattaccaaaactttaatgttcaaccaattcataaaaagtcaggtgtgacaagt
cgtctgcttgggcaatcttatgaaccctatttgttgcctgaattgaccagatatgactgt
gaggtgaatgtccctgttttgggcagttctacacttctgcaaggaagtgatttgctcaga
gctcttgaccaggcgacctga

DBGET integrated database retrieval system