KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102453233
Entry
102453233         CDS       T02980                                 

Gene name
NPAS3
Definition
(RefSeq) neuronal PAS domain-containing protein 3 isoform X1
  KO
K09098  neuronal PAS domain-containing protein 1/3
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pss03000]
    102453233 (NPAS3)
Transcription factors [BR:pss03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102453233 (NPAS3)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH
Other DBs
NCBI-GeneID: 102453233
NCBI-ProteinID: XP_006117725
Ensembl: ENSPSIG00000017064
Position
Unknown
AA seq 957 aa
MIRIFPDFSVQVTAAAAGGAAGGVPAGPGMGRASTAANGNPQNVQGITSYQQRITVQHPL
PNQSECRKIYRYDGIYCESTYQNLQALRKEKSRDAARSRRGKENFEFYELAKLLPLPAAI
TSQLDKASIIRLTISYLKMRDFANQGDPPWNLRMEGPPPNTSVKGIQMWKSEVCMRKTPC
EVIGAQRRRSPSALAIEVFESHLGSHILQSLDGFVFALNQEGKFLYISETVSIYLGLSQV
ELTGSSVFDYVHPGDHVEMAEQLGMKLPPGRGLLSQGTAEDGASSASSSSQSETPEPVES
TSPSLLTTDNTLERSFFIRMKSTLTKRGVHIKSSGYKVIHITGRLRLRVSLSHGRTVPSQ
IMGLVVVAHALPPPTINEVRIDCHMFVTRVNMDLNIIYCENRISDYMDLTPVDIVVKSIH
AEDVEGIRHSHLDLLNKGQCVTKYYRWMQKNGGYIWIQSSATIAINAKNANEKNIIWVNY
LLSNPEYKDTPMDIAQLPHLPEKTSESSETSDSESDSKDNSEDNENSKSDEKGNQSENSE
DPESDRKKSGNQSDNEMNCNDDGNSSSNQDSRDSDDSFENSDFENQKAPEDSFGTLGSMQ
IKVERYVESESDLRLQNCESLTSDSAKDSDSAGEVNAQSSSKHQKRKKRRKKQKGGSMTR
RRLSSTSSPNGLDSALVDQPQLLSSPNSASVLKIKTEISEPINFDNDSSIWNYPPNREIS
RNESPYSMTKPPSSEHFPSPQASSSLHVSIPDSVLTPPGSENTASRKTQFSTSSSSALAP
VSSDPLSPPLSASPRDKHPGGPSTSNSLLYTGDLEALQRLQAGNVVLPLVHRVTGTLAAT
STAAQRVYTTGTIRYAPAEVTLAMQGNLLPNTHAVNFVDVNSPSFGLDPKTPMEMLYHHV
HRLNMSGPFGSAVSGASLTQMPAGNVFTTAEGLFSTLPFPVYSNGIHTTQTLERKED
NT seq 2874 nt   +upstreamnt  +downstreamnt
atgatcaggatcttcccggatttcagcgtgcaggtgactgcggcggcggccgggggggcg
gccgggggagtgccggccgggccaggcatggggagagccagcaccgcagccaacggcaac
ccgcaaaacgttcagggcatcacttcctaccaacaacgaataactgtccagcatcctctg
cccaaccaatcagaatgtaggaaaatctacagatatgacggaatctactgtgaatctacc
taccagaatttacaagccttgagaaaagaaaagtcccgagatgctgctcgctctcgccgg
ggaaaggaaaattttgaattctacgagttggcaaaattgttgccgctccctgcagccatt
acaagtcagcttgacaaggcatccatcatccgacttacaattagctatctgaaaatgagg
gactttgctaatcagggggatcctccgtggaacttgagaatggaaggacctccacctaac
acctcagtaaaagggatacaaatgtggaaatctgaggtctgcatgagaaagacaccatgt
gaagttataggtgctcagcgcaggagaagccccagtgcacttgccattgaagtatttgaa
tcacatttgggaagtcacattttacagtccctggatggatttgtatttgcactaaaccaa
gaaggaaaatttttgtacatttcagaaaccgtctccatctatttaggcctatcccaagtg
gaactgacaggcagcagtgtgtttgactatgtccaccccggagaccatgtggagatggca
gagcagctgggcatgaagcttcccccaggacgaggccttctctcgcagggtacagcagag
gatggagccagctcagcatcttcatcttctcagtctgagacccctgagccagtggaatca
acaagccctagtctactaaccactgacaacaccctagagcgctcttttttcatccgaatg
aaatctacactgaccaagcgaggagtgcacatcaaatcatcgggatacaaggtgatccac
ataacaggccggttacgactgagagtatcattgtcccatgggcggacagttcctagccaa
atcatggggcttgtagttgtcgcacatgctttgccccctcctacaatcaatgaagtcaga
atcgactgccacatgtttgttactcgcgtaaatatggacctcaatatcatttactgtgaa
aataggattagtgattacatggatctgacccctgtagatattgtagtgaaaagcattcat
gctgaagatgtggaagggatcagacatagtcacttggacttgctgaataagggtcagtgt
gtaactaaatattaccgttggatgcagaagaatggagggtacatctggatacagtccagt
gctaccatagctatcaatgccaagaacgcaaatgagaagaatatcatctgggtcaattac
cttcttagtaacccagagtacaaagacacgccaatggatattgcacaacttcctcatctg
ccagagaaaacctccgaatcatcagagacctctgattctgaatcagactcaaaagacaac
tcagaggacaatgagaactccaagtcagatgagaaaggaaaccaatcagaaaacagcgaa
gaccctgaatctgataggaagaagtctgggaatcagtcagataacgaaatgaactgtaat
gatgatgggaacagctccagcaaccaggacagcagggacagtgatgacagctttgaaaat
tctgactttgagaatcaaaaggccccggaggacagttttggtactcttggttctatgcag
atcaaggtggagcgctatgtggagagtgaatcagacttgcggttgcagaattgtgaatcg
ttgacgtcagacagcgccaaggactcggacagtgcaggggaagtaaatgcccagtcttcc
agcaaacatcaaaagaggaagaagaggaggaaaaagcagaaaggaggcagcatgacccgc
agaaggctgtcaagcacttcaagcccaaacggacttgactcagctttggtggaccagccc
cagctgctctcgtcaccaaacagtgcctcagtgctcaaaattaaaacagagatctcagaa
cctatcaattttgataatgatagcagtatttggaattacccgcctaacagggaaatctca
aggaatgaatcaccctacagtatgaccaagcccccaagctcagagcacttcccctcccca
caagccagcagtagtttacatgtctccattccagactccgttctcaccccaccggggtct
gaaaatactgccagccgcaaaactcagttcagcacctcatccagctcggccttggctcct
gtgtcctctgaccctttgtcacccccgctttccgcatctccacgggacaaacatccagga
ggtcccagcacttccaactctttgttgtacactggggatctggaagcccttcagaggttg
caagcaggcaatgtggtccttcctttggttcacagggtaactggaacccttgctgccacc
agcactgctgctcagagggtctacaccactggcactattcggtatgctccagctgaagtt
actttagccatgcagggcaacctcctccctaatacccacgctgttaactttgttgatgtt
aacagccccagctttgggctggatcctaaaacaccgatggaaatgctctaccaccacgtt
caccgactcaatatgtcaggaccatttggaagtgctgtgagcggggccagtctgacccaa
atgcctgcagggaacgtgttcacaactgccgaaggacttttttccactcttccatttcct
gtgtacagcaatggcattcacactacacagactctggaacggaaagaggattga

DBGET integrated database retrieval system