KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102453387
Entry
102453387         CDS       T02980                                 

Gene name
ARNT2
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator 2 isoform X1
  KO
K15589  aryl hydrocarbon receptor nuclear translocator 2
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pss03000]
    102453387 (ARNT2)
Transcription factors [BR:pss03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102453387 (ARNT2)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_9 PAS_4 PAS_2
Other DBs
NCBI-GeneID: 102453387
NCBI-ProteinID: XP_006139333
Ensembl: ENSPSIG00000010366
Position
Unknown
AA seq 729 aa
MASDIPGSVTLPVAPMATGQVRMAGSMPARGGKRRSGMDFDDEDGEGPSKFSRYDDDQIS
GDKEKFARENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMR
GTGNKSTDGAYKPSFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSE
WFGSTLYEQVHPDDVEKLREQLCTSENSMTGRILDLKTGTVKKEGQQSSMRMCMGSRRSF
ICRMRCGNAPLDHLPLNRITTMRKRYRNGLGPVKEGEAQYAVVHCTGYIKAWPPAGMTIP
EEDADVGQGSKYCLVAIGRLQVTSSPVCMDMNGMSVPTEFLSRHNSDGIITFVDPRCISV
IGYQPQDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSS
FTFQNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNIPANVHEGG
KPVEKPDTIFSQERDPRFAEMFAGITASDKKMMASASPAGNQQLYSQGSPFQPGHSGKAF
RKNATLTRNSSSVVHVPGVNDIQSSSSTGQNLTQISRQLNQGQVAWTGSRPPFPGQQIPS
QSGKAQSSPFGIGTSHTYPADPSSYSPLSSPATSSPSGNAYSNLANRGAGFAESGQSSGQ
FQGRPSEVWSQWQSQHHNQQSSDQHSHQQPSQTEVFQDMLPMPGDPTQGTGNYNIEDFAD
LGMFPPFSE
NT seq 2190 nt   +upstreamnt  +downstreamnt
atggcttcagatattcctggatcagtgactttgccagttgcaccgatggcaacaggacag
gtgagaatggcaggatccatgcctgctagaggaggaaagaggcggtctggaatggacttt
gatgatgaagatggggaaggtcccagcaaattttcaaggtatgatgatgatcaaatctct
ggtgataaggaaaaatttgcaagggagaaccatagtgaaattgaaaggcgcaggaggaat
aagatgacacagtatatcacggagctgtcggacatggtgcccacctgcagtgcattggca
cgtaaacctgacaagttgacaattctgcgtatggctgtttcacacatgaagtctatgagg
ggcactggaaataaatctactgacggggcatataagccttctttcctaacagaacaggaa
ctgaaacatcttatcctggaggctgccgatgggttcctgtttgtagttgcagcggagact
gggagagtcatctacgtatccgattccgtcactccagtgctgaaccagccacagtcagag
tggtttggcagcacgctctatgagcaggttcatccagatgacgtggaaaagctgagagag
cagctgtgtacatctgaaaactctatgacagggcgaattttggacttaaaaaccgggaca
gtaaagaaggaaggtcagcagtcctcaatgagaatgtgcatgggatccagacgctccttc
atttgcagaatgaggtgtggaaatgcccctttggatcatttacctctgaacagaataact
accatgcgaaaaagatacaggaatggcctaggcccagtaaaagaaggagaagcacagtat
gcagtagtccactgcactggatatatcaaggcctggcccccagcaggaatgactatacca
gaagaagatgcagatgtgggacaaggtagtaaatattgccttgtggcaatagggaggctg
caggtaactagctcacctgtgtgcatggacatgaatggaatgtctgttcccaccgagttc
ttgtctagacacaactctgatggaataatcacatttgttgatccaagatgtatctctgtg
attggctaccaaccgcaggatcttctgggaaaagacattttagaattctgccatccggaa
gatcaaagccatttgagagagagttttcaacaggttgttaaactgaaaggccaggtccta
tctgtgatgtatcgttttcgtaccaaaaaccgggaatggatgttaattaggaccagcagc
ttcacctttcagaacccttattctgatgagattgaatacatcatttgcaccaacactaat
gttaagcaacttcagcaacagcaagctgagcttgaagtacatcagagagatgggttgtca
tcctatgacttatctcaggtacctgttccaaatataccagctaatgttcatgagggtgga
aagccagtggaaaaaccagacactatcttctcccaggagagagatcctaggtttgctgag
atgtttgcaggaataactgcttcagataaaaaaatgatggcttcagcatctccagcagga
aaccaacagctctactctcaggggagccccttccagccaggacattcaggaaaggctttc
agaaagaatgcaacactgacaagaaacagctcatctgtggtacacgtgcctggtgtaaat
gatatccagtcctcttcttcaacaggccaaaatttgacacagatctctcgtcagttaaat
cagggtcaagttgcctggacggggagtcgcccaccatttccaggacagcaaatcccatca
caatctggcaaggcccaatcttcaccctttggaatcggaaccagtcatacctatccagct
gatccatcatcctacagccctctctctagcccagccacgtcgtccccaagtggaaatgca
tactcgaacctagcaaacagaggtgcagggtttgctgagagtggccaaagcagtggacaa
ttccaagggagaccttcggaggtgtggtcccaatggcaaagccagcatcataatcagcaa
agcagtgaccagcattctcaccagcagcccagtcagactgaagtcttccaagacatgctg
cctatgccaggggatccaacacagggcactggcaattacaacattgaagattttgctgat
ctgggcatgtttccaccattttctgaataa

DBGET integrated database retrieval system