KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102453466Help
Entry
102453466         CDS       T02980                                 

Gene name
PLK2
Definition
(RefSeq) serine/threonine-protein kinase PLK2
  KO
K08861  polo-like kinase 2 [EC:2.7.11.21]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102453466 (PLK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pss01001]
    102453466 (PLK2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pss03036]
    102453466 (PLK2)
Enzymes [BR:pss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     102453466 (PLK2)
Protein kinases [BR:pss01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   102453466 (PLK2)
Chromosome and associated proteins [BR:pss03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102453466 (PLK2)
   Centrosome duplication proteins
    Regulators of centriole replication
     102453466 (PLK2)
  Sister chromatid separation proteins
   Polo kinases
    102453466 (PLK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr POLO_box Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 102453466
NCBI-ProteinID: XP_014435465
Ensembl: ENSPSIG00000007060
Position
Unknown
AA seq 673 aa AA seqDB search
MDLLRTIAHQPGGGGSGSSSGGPKGGEPALGRACGGEARRKKAPEEQPQHHHSQAAPEVS
RIITDPPSGKRYCRGKVQGKGGFAKCYEMTDLTTNKVYAAKIIPHTRVAKPHQREKIDKE
IELHRMLNHRHVVQFYHYFEDKENIYILLEYCSRRSMAHILKARKVLTEPEVRYYLRQIV
SGLKYLHEQEILHRDLKLGNFFINEAMELKVGDFGLAARLEPLEHRRRTICGTPNYLSPE
VLNKQGHGCESDIWALGCVMYTMLLGRPPFETTNLKETYRCIREARYTLPSSLLAPAKHL
IASMLSKNPEDRPSLDDIIRHDFFLQGFTPDRLSSSCCHTVPDFHLSSPAKSFFKKAAAA
LFGGKKEKARYFDTHNRLAKEDEEIYKLRHDLKKISITQQPHRHRTDEDTQPPNITAAKP
GTLAETKQVGDAIRMIVRGTLGSCSSSSECLEDSTMGSVADTVARVLRGCLENMPEADSI
PKEQLTASFQWVTKWVDYSNKYGFGYQLSDHTVGVLFNNGAHMSLLPDKKTVHYYAELGQ
CSVFPATDAPEQFISQVTVLKYFSHYMEENLMDGGDLPSVTDVRRPRLYLLQWLKSDKAL
MMLFNDGTLQVNFYHDHTKIIICNQSEEYLLTYINEDRISTTFRLTTLLMSGCSLELKHR
MEYALNMLLQRCN
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggatttactgcggactatcgctcaccagccgggcggcggcggcagcggcagcagcagc
ggcggccccaaggggggcgagccggcgctgggcagggcctgcggtggggaggcccggcgc
aagaaagcgccggaggagcagcctcagcaccaccactcgcaggctgcccccgaggtctcc
cggattatcaccgaccccccctcgggcaagcgctactgccgcggcaaggtgcagggcaag
ggtggatttgccaaatgttatgagatgacagatttaacgaccaacaaagtctatgctgca
aaaattattcctcacaccagagtggctaaacctcatcaaagggaaaagattgataaagag
attgagcttcacagaatgcttaatcacaggcatgttgtgcagttttaccactactttgaa
gacaaagaaaatatttacattcttctggagtactgcagtagaaggtctatggctcatatc
ttgaaagcaaggaaggtattgacagaaccagaagtgcgatactacctcaggcagatagtg
tctggactaaaatatcttcatgaacaggaaatcttgcacagagaccttaaactaggtaat
ttcttcattaatgaagccatggaactaaaagtaggagactttggtttggcagcaaggttg
gaaccactggaacacagaaggagaacaatctgtggcacaccaaattacctctctccagaa
gtcctgaacaaacaaggacatggctgtgaatctgacatatgggccttaggctgtgtaatg
tacacaatgttgttaggaagacctccatttgagactacgaaccttaaagaaacctacaga
tgtataagggaagcaagatatactctgccatcatctctgttagcacctgcgaagcactta
atagctagcatgttgtcaaagaatcccgaggaccggcccagtttagatgatataattcga
catgacttctttttacagggctttacaccagatagactctcttctagctgttgtcacact
gttcctgacttccacttgtcaagtccagctaagagttttttcaaaaaggcagctgctgct
ctgtttggtggtaaaaaggaaaaagcaagatactttgatacacataatcgactagctaaa
gaagatgaagaaatctacaaacttagacatgatttgaaaaagatatcaataacccaacag
ccgcacagacataggacagatgaggatacccagcctcctaacattacagcagccaaacct
ggaactctagcagagactaaacaggttggagatgccattcgaatgatagttagaggaact
ttaggaagctgcagcagtagcagtgaatgtttggaagacagtaccatgggaagtgttgct
gatacagttgcaagggtactgcgaggatgtcttgagaacatgccagaagcagatagtatt
cccaaggaacaacttacagcctctttccaatgggttacaaaatgggttgactactctaac
aaatatggcttcggttaccagctgtcagaccacactgttggtgttctcttcaacaatgga
gcacacatgagcctcctaccagacaaaaaaactgttcactactatgctgagctaggccag
tgctcagtctttccagctacagatgcccctgaacaatttatcagccaagtaactgttctg
aaatacttctctcactacatggaggagaacctcatggatggaggggatctgcccagtgta
actgatgttcgcagacccaggctttacctcttacagtggctaaagtctgataaagcatta
atgatgctcttcaatgatggcacgcttcaggtgaacttttaccatgatcacacaaaaata
atcatctgcaaccaaagtgaggagtatctccttacctatatcaatgaagataggatatca
acaacatttcgtctgacaacacttctcatgtcaggatgttcgttggaactaaagcacaga
atggaatatgcattgaatatgttgctacaaagatgtaactaa

DBGET integrated database retrieval system