KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102455064
Entry
102455064         CDS       T02980                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pss01002]
    102455064 (ADAMTS13)
Enzymes [BR:pss01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     102455064 (ADAMTS13)
Peptidases and inhibitors [BR:pss01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   102455064 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_4 TSP1_CCN TSP1_spondin ADAM_spacer1 Reprolysin_3 Reprolysin_5 Reprolysin_2 Peptidase_M10
Other DBs
NCBI-GeneID: 102455064
NCBI-ProteinID: XP_025040789
Ensembl: ENSPSIG00000017133
Position
Unknown
AA seq 1655 aa
MDRVFYLFMYSLLPLHVMPWAKQYNHSRPVFVVEFQRSLLSMDIINLIILTFVVIPVGFC
RPAAFQEKFLQALNPEDVFSYFGTSKVLDVPEFVIAQPSCPCEEDQVEPRSCKVQRCSLM
AWGEPYSFEFLEDCVLSSFVSDRKLNSSVSLLKRFPGSCFAGGRVLHPAGAKCRVTYCEG
WLGGVVIVNEEEIHIRPVRRKHLTVLEDLSLPTPHVIFRAARRGTRTIGERKSPPRLWKR
AEGSVVHLELLVVVGPDVYQFHREDTERYILTNLNIGAELLRDASLGAQLRVHLTRMMVL
TEPEVGINITTNVTSSLVGVCEWSKKVNPPSDSDPQHADLVLYVTRFDLELADGNKQMRG
VTQLRGACSSSWSCVITEDTGFDLGVTIAHEIGHSFGIQHDGEGNLCSGSGNVMGAEGSH
NSVDLVWSECSREQFLAFIRTSQASCLNDLPALEGSIPGWKPGLYYGADEQCKIAFGSAA
AACTFARNDIDTCRVLSCHTHQADRTSCTRLLVPLLDGTECGINKWCSKGHCSSLEELNP
VAVVHGQWSSWSPLTACSRSCGGGVVTRRRLCNNPRPAFGGQECRGADLQAAMCNTQACL
TTQLEFMAEQCAATNVKPLYLLPDVPSFYMWTSAAGYAKGDTLCRHMCRAEEKNFMVSRG
DRFTDGTRCEPSNRRTKGAFDLCVMGSCRVFGCDGRMDSGMVLDPCKVCGGDNATCTRVS
GSYTEGKAKEYVTFLALPHKTTSVHVTNRKPLFTHLAVKVQGRYVVAGKQRISLNITYPS
VVEDSQISYRVFLTEDHLPSLEEVHVDGPTYEDIEIQVAWKGWEGDSQNWFEISTLFFSI
CIFSYFIPKKKQAHVWIPQFGTCSVSCGEGVLLVDHSCFDQTRNEITDDQLCLETPRPPS
RQELCAKAPCPPGWVAGAFGPCSATCGGGVMERLVRCMKKEGGLVLTLPDSKCLDAPKPA
STEACSTELCPVRWKESEPGKCSASCGLGVSQQNVTCVRVLAGLETTVDNSLCPEDEKPP
TFVPCVVNICPLGWNTKQDSSPSPGELVPFGPIKKENRSVHVWSPLAGECSVTCGGGVAQ
LRFVCVAFETKAETHEKHCHPVPKPASRLESCNPMLCPPRCSLHSRHPSWEVKELAACPV
SCGGGRLPLSLRCVRQEGNTTRPLPHSKCGRMPRPASTKECGTDPCPARWRSKLDSCSVS
CGGGVARRVRYCARERGDKAEEVVADAQCRGLPRPEEQEPCNLEPCPPSWKVAATGPCSS
SCGLGLAAQLITCVQLRQGLETELEESSCPETERPLSRIPCFIRTCSYEWAFSEWTECSA
SCGNGIQTRQDFCLDPQARKHVNPVFCMHSPKPITVRGCSASPCPEQPAGEGSSGPQRQM
PTSATNPLTTAAATYPERPKYKALGRPPTRVLAPSPKHPKELSAGKADAAEEYSVCGSLF
LNSTGVINMTGLRVSDCTVSIGRPLGEVVTVQVLESSLNCSAGEILLFSGRMMWRTGCKK
LRGSSINSRMNTLMVRQRLLWPGNGVVLQYKSKAAAKKYYQDCDVQLFGPWGEIVNPGQL
PDPKRQVACRTFIEVAPRYRIAIHALYMDLGMENNQTHSNFILVRDVNAVKTTVFRGKQL
FFWESTGSQAEIEFHEGFTEDRISFRAAYWMSEPR
NT seq 4968 nt   +upstreamnt  +downstreamnt
atggatcgagtcttttatttgtttatgtattctctacttccgctccatgtgatgccttgg
gctaaacagtataatcactccaggccagtctttgttgtggagtttcagcgcagtcttctc
agcatggacatcatcaatttgattatcctaacgtttgtggtgatccctgtgggattctgc
aggccagcagctttccaagagaaatttctccaggcgctgaatccagaagatgttttctct
tattttggcaccagtaaagttcttgatgtaccagaatttgttattgctcagccatcttgt
ccctgtgaagaggaccaagttgaaccgagatcttgtaaagttcaacgttgctcccttatg
gcctggggagaaccctacagctttgagttcctagaggactgtgttctttcttccttcgtg
agcgatcgaaagctgaactcctctgttagtttactaaagcgattcccaggcagttgcttt
gctgggggaagagtactgcaccctgcaggggctaaatgtagagtcacttactgcgaaggg
tggctgggcggtgttgtcattgtgaatgaggaagagattcacatcagaccggtgagacgc
aaacacctgaccgtgctggaagacctcagcctccccacaccccacgtcatcttccgagct
gcacggagagggacaaggacgataggagaaagaaagtctccgcctcgtctttggaaaagg
gctgagggaagcgtcgtgcacctggagctgctggtggtagtgggcccagacgtttatcag
ttccacagagaggacaccgagaggtacatccttaccaacctgaacatcggtgccgagctg
ctgagagacgcctcgctgggagctcagcttagggttcacctgacgagaatgatggtcctg
actgaaccagaggtgggtataaacatcaccacgaatgtcacctcctccttggtcggggtc
tgcgaatggagcaagaaggtcaatcccccgagtgactcggatccccagcacgccgacctt
gtcctctatgtgaccaggtttgacctggagttagctgatggaaacaagcagatgcgcgga
gtcacccagctgaggggagcctgctcttcctcctggagctgcgtgatcactgaggacacc
ggctttgacttgggagtcaccatagcccatgagatcggtcacagttttggaatccagcac
gatggcgaggggaacctgtgcagcgggagcggcaacgtcatgggcgctgaaggcagccac
aacagcgtggacctggtctggtcagagtgcagcagagagcagttccttgccttcatcagg
acaagccaagcaagctgcttaaacgacctgccggccctggagggcagcatccctgggtgg
aagcccggcttatattacggcgcggacgagcagtgtaaaatagcctttgggagcgcagcg
gcggcgtgcacctttgccaggaatgacattgatacgtgcagagttctttcttgccacact
catcaggctgaccggaccagctgtactcgtcttcttgttccccttctggatggtaccgag
tgtgggatcaataagtggtgctccaagggacactgtagctctctggaggagctgaacccg
gtggcagtggtgcatgggcagtggtccagctggagccccctcactgcctgctcccgcagc
tgtggaggaggagttgtaacgcgaagacgactttgtaacaaccccaggcctgcattcggg
ggtcaggagtgcaggggagcagacctccaggctgcgatgtgcaacacgcaggcctgtttg
accacccagttggagtttatggctgaacagtgtgcagcgacaaacgtaaagccgctgtat
ctccttccagacgtcccgtctttttatatgtggacttcggctgctggctatgccaaaggg
gataccctatgcagacacatgtgccgggcagaggagaagaatttcatggtgagccgtggg
gaccgtttcacagatggaaccaggtgtgagccgagcaaccgtagaaccaaaggggctttt
gatctgtgcgtgatgggcagctgcagggtgttcggctgtgacggcaggatggactccggg
atggtgctggatccctgcaaggtgtgcgggggagacaacgccacgtgcaccagagtgagc
ggctcctacacggaaggaaaagccaaagagtacgtcacgtttctagctctgcctcacaag
accaccagcgtccacgtcaccaatcgcaaacctctcttcacacatttggctgtgaaagtc
caaggacggtatgtggttgctgggaagcagagaatctccttgaacatcacctatccgtcg
gtagtggaggacagccagatctcgtacagggtctttctcactgaggaccacctgccaagc
ctggaggaagtccatgtggatgggccaacctacgaggacattgagatacaggtagcttgg
aagggctgggaaggggatagccagaactggtttgagatttctacattattcttctccatt
tgtatcttcagttactttatcccaaagaagaaacaggcacatgtgtggattcctcagttc
gggacctgctcggtgagctgtggggaaggggtgttactggtagatcactcctgctttgac
cagaccaggaatgaaataacagacgatcagctgtgtttggagaccccacgtcccccttcc
aggcaggaactctgcgctaaggcaccatgcccaccaggctgggtggcgggggcctttggc
ccctgcagcgccacatgtgggggaggagtgatggagcggttggttcgctgtatgaagaaa
gaaggtggcttggtcctgactcttcccgattcgaaatgcctggatgctcccaaacctgcc
tccaccgaggcatgtagcactgagctgtgccccgtaagatggaaggaatctgagccaggc
aaatgctcagccagctgcgggctcggcgtcagccagcaaaacgtgacgtgtgtccgggtc
ctcgctggactggagaccacagtagacaacagcctgtgcccggaggacgagaaaccccct
acctttgtgccgtgcgtggttaacatctgtccactaggctggaacacaaagcaggacagt
tcgccctccccgggggagctggtgccattcgggcctatcaagaaggagaatcgctcggtg
catgtctggagccctctggctggagaatgctccgttacctgtggcggaggtgtggcccag
cttcgcttcgtgtgtgtggctttcgagaccaaagcggaaacccacgagaaacactgtcac
cccgtgccaaagccagcaagcaggctggaaagctgcaatcccatgctgtgcccgccgaga
tgttctctccattctcgtcaccccagctgggaggtgaaggagctggcggcatgccctgtg
agctgtggaggagggagactccccctctctctgcgctgtgtgagacaagaaggaaatacc
acccggcctcttcctcattccaaatgtggtaggatgccccgaccggccagcaccaaggag
tgcggcactgatccgtgcccggcaaggtggcgttccaagctggactcgtgcagcgtgagc
tgcggtggcggtgtggcgcgcagggtccggtactgtgcgagggagcgcggggacaaggcg
gaagaggttgtagcagatgcgcagtgtcgtgggttgcctcgcccggaggagcaagagccg
tgtaatttggagccgtgtcctccaagctggaaagtcgccgcgactggtccgtgttcctcc
tcttgtgggctcggcctagctgcgcagctgatcacctgtgtccagctccggcaaggccta
gagacggagctggaagagagttcatgtccggagacagagagacccctctcccgcatccct
tgtttcatccgaacgtgctcttatgagtgggctttcagcgaatggaccgagtgctcggcc
tcgtgtggcaacgggattcagacacggcaggatttctgcctcgatcctcaagcccgcaag
cacgtgaaccccgtcttctgcatgcactcccccaagcccatcacggtgcgtggctgctct
gccagcccctgtcccgagcagcctgcgggggaggggtcctcaggaccacaacgccagatg
ccaacttcagctacgaacccgctaacgacagcagccgccacgtatcccgagaggccaaaa
tacaaagctctgggtcgtcctcccaccagggtgctggctccttctcccaagcaccccaag
gagctttcagcagggaaggcggatgctgctgaagagtacagtgtctgtggaagcctcttc
ctcaactccaccggagtcatcaacatgaccggcctgcgggtcagtgactgcacggtgtcc
atcggacgccccttgggggaagtggtcacagtccaggtgctggagagctccctaaattgc
agcgcaggggagatattgctcttttctggacggatgatgtggcggacaggctgtaagaag
ctgagggggtcgtctataaactccaggatgaacacactgatggtgagacagcgcctcctg
tggccggggaatggtgtcgttcttcagtacaagagcaaagcagcagcaaaaaaatattac
caagactgtgatgtgcagctgtttggtccctggggcgaaatagtgaatcccggacagttg
ccggacccgaaacgacaagtggcatgtcggacctttattgaggtggctccacgttatcgc
atagccatccacgccctctacatggacctggggatggagaacaaccagacacactccaat
ttcattttggtacgggatgtgaatgctgtgaagacgacagtgtttcgggggaagcagctg
ttcttctgggaatcaacagggagccaggctgaaatcgaatttcatgaaggctttacagaa
gatcgcatcagtttccgagcagcatactggatgagtgagccccgataa

DBGET integrated database retrieval system