KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102455524Help
Entry
102455524         CDS       T02980                                 

Definition
(RefSeq) histo-blood group ABO system transferase-like isoform X1
  KO
K00709  histo-blood group ABO system transferase [EC:2.4.1.40 2.4.1.37]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00601  Glycosphingolipid biosynthesis - lacto and neolacto series
pss01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    102455524
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pss01003]
    102455524
Enzymes [BR:pss01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.37  fucosylgalactoside 3-alpha-galactosyltransferase
     102455524
    2.4.1.40  glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase
     102455524
Glycosyltransferases [BR:pss01003]
 Glycan extension
  ABO blood group
   102455524
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_6
Motif
Other DBs
NCBI-GeneID: 102455524
NCBI-ProteinID: XP_006136452
Ensembl: ENSPSIG00000009003
Position
Unknown
AA seq 347 aa AA seqDB search
MGCTVVLCFSLGYFWSMSNYTWQETPVKIFNTVRKIYSKPQILRPPNRTHLLENLLEIEL
PRMIYAKPQVLKPPRNDVLMMTPWFAPIVWEGTYNLDILNEQFRQRNVTVGLTVFAIKKY
VVFLKTFLETAEMYFMVGHKVNYYIFTDRPQEVPKVELKEGRNVVVLQVQNYSRWQEISM
RRMEMINHFSKKQFINEVDYLVCVDVDMRFNDLVGVEILSNLFGTLHPGFYGSERRSFTY
ERRPASQAYVPHDEGDFYYAAAFFGGTVKEVYKLTKKCHEAIMVDKDNGIEAIWQEESHL
NKYFVYHKPTKILSPEYLWDDNIGRPEILRKRRFLAVPKNHTAIRNK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcaccgtggttctgtgcttcagtcttggctacttttggagtatgtccaattat
acctggcaggaaacaccagtcaagatcttcaacacagtgagaaagatttactcaaagcca
cagattctaaggccacccaaccgtacccacctcttggagaacttgctggaaattgaatta
ccaagaatgatttacgcaaagccacaggttctaaagccaccgagaaatgacgtccttatg
atgactccatggtttgcaccaatagtttgggaagggacctataacctcgatatcctgaat
gagcagttccgacaaaggaatgtcactgtaggactaacagtttttgcaatcaaaaagtat
gtcgtatttctcaagacatttttagaaactgcagagatgtactttatggttggacataaa
gtaaactattacattttcacagacagaccacaagaagttcctaaagttgagctcaaagaa
ggaaggaacgtagtagttctgcaagtccaaaactactcgagatggcaagaaatctctatg
cgacgcatggaaatgatcaaccacttctccaagaagcagttcattaatgaggtcgactac
cttgtgtgtgttgacgtagacatgaggtttaatgacttagttggagtagaaatcctgagc
aacttgtttggcacactacacccaggattctacggttcagagcgtcggtctttcacctat
gaacgtcgacctgcttctcaagcttatgtgccccatgatgagggtgacttttactatgct
gcagcattttttggaggaacagtaaaggaggtttacaagctgaccaagaaatgccatgaa
gccatcatggtggacaaagacaatggaattgaggcaatatggcaagaagagagtcactta
aacaagtattttgtttaccacaaaccaactaaaatactttccccagaatacctgtgggat
gacaatataggtaggccagagatccttaggaaaaggaggtttcttgctgtaccaaagaac
catactgcaatcagaaataaatga

DBGET integrated database retrieval system