KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102455724
Entry
102455724         CDS       T02980                                 

Definition
(RefSeq) hypoxia-inducible factor 3-alpha
  KO
K09096  hypoxia-inducible factor 3 alpha
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pss03000]
    102455724
Transcription factors [BR:pss03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102455724
SSDB
Motif
Pfam: HIF-1 PAS PAS_3
Other DBs
NCBI-GeneID: 102455724
NCBI-ProteinID: XP_025039651
Position
Unknown
AA seq 572 aa
MRPSPGLEWGASSPGVCLPTTPMFNEQSYPKAAVGPATPGSAGSGLSASRSTTDIRKEKS
RDAARCRRSKETEVFYQLAHTLPFPRGVSAHSYLRMHKLVTSEEWRGQPEQVDACYLKAL
DGFVMVLTEEGDMAYLSENVSKHLGLTQVSGERAAAMPPSPMAAPTPSAAPLPHGAPADA
KKEVKTERSFSLRMKSTLTSRGRTVNLKSATWKVRRRGDGRSRGSPRLIAEVAGYTPEEL
LGCSIYEYIHALDSDSVSKSIHTRNQVEEMGVVLSLEQTERQGEGRRLPPDPDPASQANG
SPEELDPDTGETILNLSFGLRGARPGDAGSVAQGLCPPRAPSSLLPPAPVPASWSHTCGL
APRGLAPEVAASWGRVGVNAGLPLQDYEALDLEMLAPYISMDDDFQLSGTEQPPWLAEKR
GDPAAARRKGPPLPPASPPPRPRSSSFHGVSGREPDLPGLLRWGSETSLSQTRSLQPPEE
EPMDLEGPMVPPGGNQKDYRASHMGARKRALELSLEEEGTDFLEVVPLKRSHSSESDGFL
LPSLNLVRLVGARPGRSRERKEGAPFTPLSPL
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgagacccagtccggggctcgagtggggggcgtccagccctggagtgtgccttccaacc
accccgatgtttaatgaacaaagttatccaaaggcggctgtcgggcccgccacgccgggc
agcgctgggagcgggctgagcgccagcaggtctacgacggatatccgcaaggagaagtcg
cgggatgcggcgcgatgccggcgcagcaaggagacggaagtgttctaccagctggcccac
accctgcccttcccccggggcgtcagcgcccacagctacctgcgcatgcacaagctcgtc
acctcggaggagtggcgcgggcagccggagcaggtggacgcctgttacctgaaggcgctg
gacggcttcgtcatggtgctgacagaggagggtgacatggcctacctgtcggagaacgtc
agcaaacacctgggcctgacccaggtgagtggggagagggccgctgccatgcctccctcc
cccatggctgctcccacgccctccgctgcccctctcccccacggggcacccgctgacgct
aagaaggaggtgaagacggagcgcagcttctccctgcgcatgaagagcaccctgaccagc
agggggcgcaccgtcaacctcaagtccgccacctggaaggtccggcgcaggggagatggc
cgcagccggggcagccctcggctcattgcagaggtggcaggatacacgcccgaagagctg
ctgggctgctctatctacgagtacatccatgccctggactccgactccgtcagcaagagc
atccacacccgtaaccaggtggaggagatgggtgtggtgctgtcactggagcagaccgaa
cgccagggtgaggggcggcgcttgcctccagatcctgacccagccagccaagccaacggc
agccccgaggaactggacccggacacaggggagaccatccttaacctcagcttcggatta
cgaggcgctcgacctggagatgctggctctgttgcccagggactctgtccccccagggct
cccagctcccttctccctccggccccggttcctgcctcctggagccatacgtgtggtctt
gcccccaggggccttgccccagaggtggctgcatcttgggggagggtgggggttaatgct
gggctgcccctgcaggattacgaggcgctcgacctggagatgctggctccgtacatctcg
atggacgacgatttccagctcagcggcaccgagcagcccccctggctggccgagaagcgg
ggcgatcctgctgcggccaggagaaagggccccccgctgcccccggcctcccccccgcca
cggcctcgctccagcagcttccatggggtgtctggccgtgaacctgacctgcccggcttg
ctccgttggggcagcgagaccagcctgagccagacccggtcccttcagcccccggaagag
gagcccatggacctggaggggccaatggtgcccccaggaggcaaccagaaggattaccgt
gcctctcacatgggggctaggaagagggccctggagctgagcctggaggaggaagggact
gacttcctggaggtggtgcccctgaagcgctcccacagttctgagtctgatggcttcttg
ctgccttccctgaatctggtacgtctggtgggggccaggccaggcagatccagggaaagg
aaggagggtgccccttttacccccctgtcacctctctga

DBGET integrated database retrieval system