KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102455741
Entry
102455741         CDS       T02980                                 

Gene name
ARNTL2
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator-like protein 2 isoform X2
  KO
K09099  aryl hydrocarbon receptor nuclear translocator-like protein 2
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pss03000]
    102455741 (ARNTL2)
Transcription factors [BR:pss03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102455741 (ARNTL2)
SSDB
Motif
Pfam: PAS_11 PAS PAS_3 HLH PAS_9 PAS_4 PAS_2
Other DBs
NCBI-GeneID: 102455741
NCBI-ProteinID: XP_006127749
Ensembl: ENSPSIG00000009416
Position
Unknown
AA seq 586 aa
MEGNRCVAPELSTLINTITKPTTSCSFNTFAVEFPKKRKESDCDNQSEDGEHVKIKYFRE
AHSQTEKRRRDKMNNLIEELSAMIPQCNPMARKLDKLTVLRMAVQHFKSLKGSTSSYAEV
QYKPSFLQDGELRQLILRAADGFLFVVGCDRGKILFVSETVCKILYYDQASLIGQSLFDY
LHPKDVAKVKEQLSSSDASPREKLIDAKTGLQVHMDFQAGSARFHSGARRSFFCRIKCSR
ITVKEEKKCLPNSKKKDHRKYRTVHCTGYLKSWPPSEVGVEENDAEKGRSNCLVAIGRLH
PYIVPQKNGEIKVKPTEFVTRFAMDGKFVYVDQRATAILGYLPQELLGTSCYEYFHQDDH
SHLADTHKAVLQSKEKIFTNSYKFRTKDGTFITLKSQWFSFINPWTKELEYIVSTNTLVL
GHNESEEETLLPCGSQSSEDTSKQSFLSVPGMSTGTILGAGSIGTEIANEALNLERLQHS
PSVGELSPSDLMRKFSPTLTPKCNSEPNKELVRLCPSEMEDLETSEQNQGTVSFPSNEPL
LSDNCQLDFDAMCENDDTAMASLMNYLEAEGGLGDAVELSDIQWIP
NT seq 1761 nt   +upstreamnt  +downstreamnt
atggaagggaaccgatgtgttgcccctgaactctccacccttattaacacaataaccaag
cctaccacttcatgctcattcaatacatttgcagttgagtttccaaaaaagcgcaaagaa
agtgactgtgataaccagagtgaagatggagaacatgtgaaaattaaatatttcagagaa
gctcatagtcaaacggaaaaacgaagaagagataaaatgaataacttgatagaagaatta
tctgctatgatacctcagtgcaatcctatggcacgtaaattagacaaacttacagtatta
cgaatggctgtacaacatttcaagtcattaaaaggctctaccagttcttatgcagaagtc
cagtacaaaccttcatttttgcaggatggtgaactgagacagttaatccttagggctgcg
gatgggttcctctttgtggttggatgtgacagaggaaaaattctttttgtctctgaaaca
gtctgcaagatactttattatgatcaggccagtttgattggacaaagtttatttgactac
ttgcatccaaaagatgttgccaaagtgaaggagcaactatcctcttcagatgcttcacca
agagaaaagcttatagatgctaaaactggcttgcaagtacatatggattttcaagctggg
tcagctcgatttcattctggtgctcggcgttccttcttctgtcggataaagtgtagtagg
atcacagtcaaggaggaaaagaaatgcttgcccaactcaaagaagaaagatcacagaaag
tatcgtacagtccactgtactggctatctgaagagctggcctcctagtgaggtgggagtg
gaagagaatgatgcagaaaaaggcagaagtaactgtcttgttgcaattgggagattgcat
ccttatattgttccacaaaagaatggtgagataaaggtcaagccaacagaatttgttaca
cgctttgccatggatggaaaatttgtttatgtagaccagcgcgcaacagcaattttagga
tatctgccacaagagcttctaggaacttcttgttatgagtacttccatcaagatgatcac
agtcatctagctgatacacacaaagcagtgttgcagagtaaagaaaaaatatttacaaat
tcctacaaattcagaacaaaagatggaactttcattacattgaagagtcagtggtttagt
ttcatcaatccatggaccaaagaactggaatacattgtatcgaccaacactctagtgttg
ggtcataatgaatcagaagaagaaacattactaccctgtggttcccagtcctcagaagat
acttcaaagcagtcttttctcagtgtacctgggatgtccactggaacaatacttggtgct
ggaagcataggaactgagattgcaaatgaagcattaaatttagaaagattacaacattct
ccatctgttggtgagttaagtccatctgatcttatgaggaaattttccccaacgttaact
ccaaaatgcaacagtgagccaaataaagagctggttcgattatgtccttcagaaatggag
gacttggagacctctgagcaaaatcagggcactgtttctttcccaagcaatgaacctctt
ctcagtgacaattgccaattagattttgatgcaatgtgtgaaaatgatgacactgccatg
gcttctctcatgaattacttggaagctgaaggaggccttggggatgctgtagaactcagt
gatatacaatggattccctag

DBGET integrated database retrieval system