KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102456010
Entry
102456010         CDS       T02980                                 

Definition
(RefSeq) delta(14)-sterol reductase isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00100  Steroid biosynthesis
pss01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    102456010
Enzymes [BR:pss01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     102456010
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 102456010
NCBI-ProteinID: XP_006136634
UniProt: K7FES9
Position
Unknown
AA seq 420 aa
MMDRYKIPRTKELEFGGPLGAVILIFLMPATVFYLLLTCGTEQASVLNFPPPLPPLSTLW
NPHTFLLLLAWVGLQAALYMLPMGKVTEGIVLRDKRRLQYRINAFHAMGVTALVVGAGLA
AGLRLSYIYDHFLQLAFSALLLAFGLSFLLYFKSLFAPETALAPGGNSGNPIYDFFMGHE
LNPRVGSFDLKYFCELRPGLLGWALVNMAMLVKETELRGSPSLAMLLVNAFQLLYVVDAL
WNEEAILTTMDIVHDGFGFMLAFGDLAWVPFTYSLQAYFLVNHPQKLSLPMAVGILLLNG
LGYCIFRSANSQKNTFRRNPNDPRVAGLKTIPTATGRRLLVSGWWGFVRHPNYLGDLIMA
LAWSLPCGLTHVLPYFYVIYFTMLLIHREARDEHQCLRKYGLAWQEYCRRVPYRIFPYLY
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgatggatcgctataagatcccacgcaccaaagagctggagtttggagggcccctggga
gccgtgatcctcatctttctcatgccagctactgtcttctatctcctgctgacatgtggc
acagagcaagccagtgtgctgaacttcccgcctccacttccacccctgagcaccctctgg
aacccccacaccttcctgttgctcctggcttgggtcgggctgcaggctgccctctacatg
ctgcctatggggaaggtcacagaagggatcgtccttcgagacaagaggcggctccagtat
cgtatcaatgctttccatgcgatgggcgtcacagccctcgtggtgggggctggactggca
gccggactccgcctcagctacatctatgaccacttcctgcagttggctttctcggccttg
ctgctggcctttggcctcagcttcctcctctatttcaagtccctctttgctccggagaca
gcactggcacctggtgggaactcagggaaccccatatatgacttcttcatgggccacgag
ctgaaccctcgcgtcggctccttcgacctgaagtatttctgcgagttgcgtccaggcctc
ctgggctgggcactggtgaacatggccatgctggtgaaagaaactgagctgcgaggcagc
ccctcgctggccatgctcttggtcaatgccttccagctgctctatgtggtggatgcactg
tggaatgaggaggccatcctcaccaccatggacattgtgcatgatgggtttggcttcatg
ttggcctttggggaccttgcctgggtgcccttcacctacagcctccaggcctatttcctg
gtcaaccacccccagaagctgagcctgcccatggctgtcgggatcctcttgttgaatggt
ctgggctactgcatcttccgcagcgccaattcccagaagaacactttccgcaggaacccc
aatgaccccagagtagctggtctcaaaaccatccccacagccacaggccggcggctcctg
gtgtctggctggtgggggtttgtgcgccaccctaactacttgggggatctcatcatggct
ctggcttggtcactgccctgtggccttacacatgtcctgccctacttctacgtcatctac
ttcaccatgctgctgattcaccgggaggcccgggacgagcaccagtgcctgcggaagtac
gggctggcctggcaggagtactgccggcgagttccctacaggatcttcccttacctttat
tga

DBGET integrated database retrieval system