KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102457143Help
Entry
102457143         CDS       T02980                                 

Gene name
CDK15
Definition
(RefSeq) cyclin-dependent kinase 15
  KO
K15594  cyclin-dependent kinase 15 [EC:2.7.11.22]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pss01001]
    102457143 (CDK15)
Enzymes [BR:pss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     102457143 (CDK15)
Protein kinases [BR:pss01001]
 Serine/threonine kinases: CMGC group
  CDK family
   102457143 (CDK15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 102457143
NCBI-ProteinID: XP_014432800
Position
Unknown
AA seq 434 aa AA seqDB search
MGEVLCVNALKPGSCCCCSDRKNSQTSQSTQSVEVESMLKLPDLKRVPHPMDSLQSQWFQ
TLPVQRSGRKRPRSNSDPSQEMDFEKRFQWRQGLPFGTASSYLYLEKLCEGSYSTVYKGI
SRINGQLVALKVISLETEEGMPFTAIREASLLKSLKHANVVLLHDIIQAKDTLTFVFEYM
HTDLAQYMVQHPGGLHAHNVMLFMFQLLRGLAYIHQQHILHRDLKPQNLLISCLGELKLA
DFGLARAKSIPSQTYSSEVVTLWYRPPDVLLGATDYSSDLDIWAAGCILVEMLQGQPMFP
AAAGTLEQLGKIWAVLGVPSEDTWPGISKLPNYKPERVVSRRPQRLQMIYSRLGRVPGAE
DLASKMLKAFPRARVSAQDTLLHSFFRALPSRLSQLHDAQSLFAVPGVRLEPEICDLFAP
YQKGHRQASSSKFW
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgggggaagtgctgtgtgtaaatgctctgaaacctggatcatgctgttgctgttcagac
agaaagaactctcagaccagccagagtacccagtccgtggaagtggagtctatgctgaag
ttaccagatctgaagagagtgccacatcccatggattcgctccaatcacagtggttccaa
acactcccggtacaaaggtctgggagaaagagaccacggagtaacagcgatccttcacag
gagatggatttcgagaagagattccagtggagacagggcctcccatttggaacagcctca
tcctatctctatttagagaagctgtgcgaaggctcttactctacagtttacaaggggatt
agcagaataaatggccagttggtggctttgaaagttatcagtctggagacagaggaagga
atgccttttactgccatccgggaagcttctcttctcaagagtctgaaacatgccaatgtt
gtgcttctgcatgacattatccaggcaaaggacacgctgacatttgtcttcgagtacatg
cacacagatctggcccagtacatggtccagcaccctggaggacttcatgctcacaacgtc
atgttgttcatgttccaacttttgcgaggcctggcttacatccaccaacaacacattctt
catcgtgatctgaagccccagaacttgctcatcagttgcctgggcgagctcaaattagct
gattttggtcttgcgcgtgccaagtccatccccagtcagacgtactcctctgaggtggtg
acgctctggtaccgtcctcctgatgtgctgcttggagccacggattattcttctgatttg
gacatctgggctgcaggctgtatattggttgagatgctccagggtcagcccatgttccca
gcagctgctgggactctggaacagctggggaagatctgggcggtgttgggggttccatct
gaggatacttggccaggaatttccaagcttcccaactataaaccagagagggtcgtctcc
aggagacctcagaggctccaaatgatctattccaggctgggcagggtgccaggcgctgaa
gacctggcatcgaaaatgttaaaagcttttcctcgagcacgggtctctgcacaggacaca
cttcttcatagcttcttcagggctctgccgtctcgcctgtctcagcttcatgacgcacag
tcactgtttgcagttcctggagtgaggctagagccagaaatctgtgacctatttgcacct
taccagaagggtcaccgccaagccagttcaagcaagttttggtga

DBGET integrated database retrieval system