KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102457193
Entry
102457193         CDS       T02980                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: neuronal PAS domain-containing protein 3-like
  KO
K09098  neuronal PAS domain-containing protein 1/3
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pss03000]
    102457193
Transcription factors [BR:pss03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102457193
SSDB
Motif
Pfam: PAS_3 PAS_11 PAS PAS_9
Other DBs
NCBI-GeneID: 102457193
NCBI-ProteinID: XP_025038659
Position
Unknown
AA seq 637 aa
MTAPCAFAAAGKQTPPVALQERPRLSISGTWLGRRLTSLPIHNLLSPPARQVIHVTGRLR
PRLPSFSHAHSVLGRVLGLVALAHTLPPSTLSEVRIECHMFVFRVNMDLQIVYCESRVSD
YMDLCSSELVGKSCYQFVHGEDVEGIRQSHLDLLQKGQVVTRYYRWLQKNGGFVWIQSCA
TISVNIKNPSEKNMVWVNYILSKPECKSMALDVFQLPGMPARQTDASDMSDLEPDFKESD
RGPEGKQGEQFLPKMAGALAKGYSRSTLDNGARCSMAENDASSPDTSYKDEETSEEAGAS
DTERRRGPQSKRIKLEFQAESPPHMASLASTEESDSGSENMAAGRNAGPSRPCTSEFASV
IQTQRSYPPKAGAALSIKTEQSQAPKYDKASPWTYPSARDAHKGAAYTVSKALSLEKPIL
RQSSSHLYVSIPDSVLTPPEMDSSGGLAKAPFSTSPRAVLPAPSAETLSPPLSGSPCEER
TTSTPFAPLVYPGEMEALQRFHAGNMVLPLVHQLGGHHGLASTTGSQSLYTTSTIRYAPA
DVTLAVPGGVLPASHAINLMDISSPESKTSMELMYHHIQRLNMVTPFGNSAGATGLAQLS
GAAGGVFTAAESLFSTLPFSMAGGGIHSLSASERKED
NT seq 1914 nt   +upstreamnt  +downstreamnt
atgacagcgccttgcgcctttgctgcagcaggaaaacagactcctcctgtagccctgcag
gagaggcccagactcagcatcagtggcacgtggctgggcagacgtctcacttccttgccc
atccacaaccttctttctccccccgcccgccaggtgattcacgtcactggccgcctccgc
ccccgtctgccgtccttctcccacgcccattcagtcctgggccgagtcctggggctggtg
gccctggctcacacgctgccgccatccacgctcagcgaggtgcgcatcgagtgccacatg
tttgtgttccgggtcaacatggacctgcaaatcgtgtactgcgagagcagggtcagcgac
tacatggacctgtgttcctcggagctggtaggaaaaagctgctaccagtttgtccatggc
gaggacgtggaaggaatccggcagagccacttggatttgctgcaaaaaggccaggtggtg
accagatattaccgctggctacagaagaacgggggctttgtgtggattcagtcctgcgcc
accatctcggtcaatatcaagaaccccagcgagaagaatatggtctgggtcaattacatc
ctcagcaaacccgagtgtaagagcatggccctggacgtcttccagctgcctgggatgcca
gcccgacagaccgatgcctccgacatgtccgacttggaaccagacttcaaagagagcgac
cgtgggccggaaggcaagcagggggagcagtttctgcccaagatggctggggccttggcc
aaaggctactcccggagcacgctggacaatggggcccgttgctccatggcggagaacgat
gccagcagcccggacacgagctacaaggacgaggagacttcggaggaagccggggcaagc
gacaccgagcggcgccgggggccccagagcaaacggatcaagctggagttccaggcggaa
agccctccccacatggcctcgctcgccagcacggaggagtcggacagcggcagcgagaat
atggcagcagggaggaacgcggggccgagccggccctgcacatcagaatttgcctccgtc
atccagacgcagaggagctacccaccgaaagccggcgcggcgcttagcattaagacggag
cagagccaggctcccaagtacgacaaggcctccccgtggacctacccctccgcccgggat
gcccacaagggagccgcctacactgtgagcaaagcacttagcctggagaagcccattctg
aggcaatcctcttcccacttgtacgtctccatcccggactcagtgctcacccctccggag
atggacagcagtgggggcttggctaaggcccccttcagcacctccccccgggcggtgctt
ccggccccttcggccgagacgctctctccgccgctctcgggttcgccctgcgaggagagg
accacctcgacaccctttgcccccctggtctatcccggcgagatggaggcgcttcagcga
ttccacgcggggaacatggtcctcccactggtgcatcagctcggtgggcaccacgggctc
gccagcaccacgggctcccagagcctctacaccaccagcactatccggtacgcccctgcc
gacgtgaccctagctgtgcccggcggtgtactgcccgcctcccatgcaatcaacctcatg
gacatcagcagcccggagtccaagacctccatggaactcatgtaccatcacatccagcgg
ctcaacatggtgacgcccttcgggaactcggccggcgccaccggtctggcgcagctttcg
ggcgccgcggggggcgtgttcacggccgccgaatccttgttctccacgctgcccttctcc
atggccggcggaggcatccacagcctgtccgcctcggagcgcaaagaggactga

DBGET integrated database retrieval system