KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102457736
Entry
102457736         CDS       T02980                                 

Gene name
HIF1A
Definition
(RefSeq) hypoxia-inducible factor 1-alpha isoform X3
  KO
K08268  hypoxia-inducible factor 1 alpha
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04137  Mitophagy - animal
pss04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:pss00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102457736 (HIF1A)
   04137 Mitophagy - animal
    102457736 (HIF1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pss03000]
    102457736 (HIF1A)
Transcription factors [BR:pss03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102457736 (HIF1A)
SSDB
Motif
Pfam: PAS_3 PAS_11 HIF-1a_CTAD PAS HIF-1 PAS_9 PAS_4 HLH DUF2121
Other DBs
NCBI-GeneID: 102457736
NCBI-ProteinID: XP_006110827
Ensembl: ENSPSIG00000010467
UniProt: K7FUG2
Position
Unknown
AA seq 803 aa
MLKFKISSDRRKEKSRDAARCRRSKESEVFYELAHQLPLPHTVSAHLDKASIMRLTISYL
RMRKLLDSSDLETEAKMEKEMNCFYLKALDGFVMVLSEDGDMIYMSENVNKCMGLTQFEL
TGHSVFDFTHPCDHEELKEMLTHRNGLVKKGKEQNTERSFFLRMKCTLTSRGRTVNIKSA
TWKVLHCTGHVRVYDTCNNQTHCGYKKPPMTCLVLICVPIPHPSNIEVPLDSKTFLSRHS
LDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFAKGQVTTGQYRM
LAKHGGYVWVETQATVIYSTKNSQPQCIVCVNYVLSEIVQEELFFSLGQTERVLKPVESV
DMNMTKIFSKADLEDSNSLFEKLKKEPDALTLLAPAPGDTIVSLDFDSNESDEQQFDEVP
LYNDVMLPSSSEKLQNINLAISPLPASETTKPLRSNADPALNREVVSKLESNTEPLELAF
SSRPRQEQPSSPSDTSTNQSSPEPHSPNDYCFDVDNDMANEFKLELVEKLFAIDTEAKNP
FSTQETDLDLEMLAPYIPMDDDFQLRSFDQPPPLESGCANSQNVASTVFHQTQTISAAAE
EIIPVKTECMDDVKTLIVSQSPVLVINEIDSTPASPYGGNRSRTASPIRAGKGTLEQTEK
SYPGTPNLLTVTLSNRSNPVDEELNPKMLALHNSQRKRKMEYDGSLFQAVGIGSLFQQSG
DCGTNASLWKRVKGCKSNGQNGVGQKTIILLSTDIASKLLGQSMDETGLPQLTSYDCEVN
APIQGSRNLLQGEELLRALDQVN
NT seq 2412 nt   +upstreamnt  +downstreamnt
atgttaaaattcaagattagctcagatcggagaaaggagaagtctagagatgcagccaga
tgcagaagaagcaaggaatcagaagtcttctatgaacttgctcaccagctgcctcttcct
catacagtgagcgcacaccttgataaggcttccattatgaggctgacaatcagctaccta
cgcatgagaaagctgttagactcaagtgacctggagacagaagccaaaatggagaaggag
atgaattgcttttacttaaaagcccttgatggatttgtcatggttctttccgaggatggt
gacatgatttacatgtctgaaaatgtgaacaagtgtatgggcctcactcagtttgagctg
accgggcacagtgtgttcgattttacccatccatgtgaccacgaagagctgaaagaaatg
cttacgcacagaaatggtcttgtgaaaaagggcaaagaacagaatacagagcgtagcttt
ttcctcagaatgaagtgcacactgaccagcaggggaaggacagtgaatataaagtctgca
acctggaaggtacttcattgcacagggcatgttcgagtgtatgatacctgcaataatcag
actcactgtggatataaaaagcctcctatgacatgcttggtgttgatctgcgtacctatt
cctcatccatcaaacattgaagtccctttggacagtaagacattcctcagtcgccacagc
ctggatatgaaattttcatattgtgatgaaagaattacagagctgatgggatacgaacca
gaagaactcttgggtcgctccatctatgaatactatcatgctctggactctgatcatctg
accaaaacacatcatgatatgtttgctaaagggcaagtgactacaggacagtacagaatg
cttgctaaacacggtggatatgtctgggttgaaactcaagcaactgttatatacagcact
aagaactcccagccacagtgcatagtgtgtgtaaactacgtcttgagtgaaattgtgcag
gaggagttattcttttcccttgggcaaactgagcgcgtgctgaagccagtggagtcggtt
gatatgaacatgaccaaaatattcagcaaggctgacctagaagattctaacagtctcttt
gaaaaactgaaaaaggaacctgatgctttaactttgcttgcgccagctcctggagacacg
attgtctctttagatttcgacagtaatgagtctgatgagcaacaatttgatgaagttcct
ttgtataatgatgtaatgctcccctcatccagtgagaaattgcagaatataaatttggca
atatcccccctgcctgcctctgaaactacaaagccacttcgtagcaatgctgaccctgca
ctcaatagagaagttgtatcaaagctggagtcaaatacagagccactagagcttgcattt
tccagtcggccgaggcaagaacagccatccagcccttctgatacaagcaccaaccaaagt
tcacctgagccccatagtcccaatgactattgctttgatgtggataatgacatggctaat
gagtttaagttggaattagtggaaaaactctttgcaatagacacagaagcgaaaaatcct
ttctctactcaggaaacggatttagatttggagatgttagctccttacatcccaatggat
gatgacttccagttacgatcctttgatcaaccacctccactggaaagtggttgtgctaac
tctcagaatgtggccagcaccgtatttcaccaaactcagacaatatctgctgctgctgag
gaaataataccagtgaaaacagagtgcatggatgatgttaaaactctaatagtttctcag
tctcctgtcctcgtaatcaatgaaatcgacagcaccccagcatcaccatatggtggaaat
cgaagtcgaactgcatctccaatcagagctggtaaaggaacattggagcagacagagaaa
tcttatccaggaacacccaatttgttaacagtcactttgagtaacagatctaatccagtg
gatgaagaactaaatccaaagatgctagctttgcataactctcagagaaagcgaaagatg
gaatatgatggctcactttttcaagcagtgggaattgggtctttattccagcagtcgggt
gattgtggaacgaatgcatcactttggaagcgtgtaaaaggatgcaaatctaatggccag
aatggagttggacaaaagacaatcatcttattatcaaccgatatagcaagtaaactccta
gggcagtcaatggatgagactggactaccacaacttaccagttatgattgcgaagtaaac
gctcccatacaaggcagcagaaacctgctacagggtgaagaattacttagagctctggat
caagttaactga

DBGET integrated database retrieval system