KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102457898Help
Entry
102457898         CDS       T02980                                 

Gene name
NOP58
Definition
(RefSeq) nucleolar protein 58
  KO
K14565  nucleolar protein 58
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:pss00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    102457898 (NOP58)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pss03009]
    102457898 (NOP58)
Ribosome biogenesis [BR:pss03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    102457898 (NOP58)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT DUF2247 tRNA-synt_His RNA_polI_A34
Motif
Other DBs
NCBI-GeneID: 102457898
NCBI-ProteinID: XP_006130811
Ensembl: ENSPSIG00000011773
Position
Unknown
AA seq 583 aa AA seqDB search
MVDEDGGHRSPYTAQGYVEHHEIWGNLALTPTPCLCWGKPEVLALQDKVVGYPKKQNEHA
LRSPGAFWSLNQVLDEKKLQEVDTLWREFETPEKANKIVKLKHFEKFQDTTEALAASTAL
VEGKLSKSLKKILKKLVAKDAHEQLAIADAKLGGVIKDKLNLSCIHSPMVTELMRGIRSQ
IEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNYIMR
CREWYGWHFPELGKIITDNLMYCKCVWKVGDRKNVSTADLSDILPEEIEEDVKTAAEISM
GTEVSEEDINNILHLCNQVIDISEYRTQLYDYLKNRMMAIAPNLTVMVGELVGARLIAHA
GSLLNLAKHPASTVQILGAEKALFRALKTKRDTPKFGLIYHASLVGQSAAKNKGKISRML
AAKTALTIRYDALGEDSSAEMGAENRLKVETRLRHLEERGIRRISGTGKALARADKYQHR
SEVKTYDPSGDSTLPAVPKKRKIEEMEEGQTEVTVKAKKIKVEIIEEEDVEESEPVKKKK
KKKEKKQRIEEEAASTEEPSTSTAMESTEKKKKKKKIKIEQED
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggtagatgaggatgggggccatcggagcccatacacagcacaaggctatgtagagcac
catgaaatttggggcaatttggctttaactccaacgccatgcctttgctgggggaaacca
gaggttctggctctgcaggacaaagtggtggggtaccccaaaaagcagaatgaacacgcg
ctccgcagccccggtgctttctggagcttgaaccaggttctggatgaaaagaaactccag
gaagttgatactttgtggagagaatttgaaactcctgaaaaagcaaataaaatagtgaag
ttgaaacactttgaaaagtttcaggatacaacagaagcccttgctgcatccacagccctg
gtagagggcaagctcagcaagagcttgaagaaaattctaaagaagttagtggcaaaagat
gcccatgaacagctggcaatagcagatgccaaacttggaggtgtcataaaggataagctg
aacttaagttgtattcatagcccaatggttactgaactgatgagaggaattcgttctcag
atcgaggggcttattactggccttccatcacgggaaatggctgctatgtgtttaggattg
gcgcatagcctctcccgatacaagctgaaattcagcccagacaaagtggatacaatgatt
gttcaagcaatctcccttcttgatgatctagataaggagctgaataactatatcatgcgc
tgtagggagtggtatggctggcacttccctgaactaggcaaaatcatcacagataaccta
atgtactgtaaatgtgtgtggaaagttggagacagaaaaaacgtttctaccgctgacctc
tcagacatcctgccagaagagattgaggaggatgtcaagactgctgcagagatctccatg
gggacagaagtatcagaagaagatataaacaatatactgcacctttgtaaccaggtgata
gacatctcagagtaccgaacgcagctgtatgattatctcaagaacagaatgatggccatt
gcacctaatctcactgttatggtgggtgaattggttggagcaaggctcattgctcatgca
ggttcccttttgaatctggctaaacatccagcttccactgttcagattttgggtgctgag
aaagctctttttagagccctgaagactaaacgggacactcccaagtttggcctaatttat
catgcttccctcgtgggacaaagtgctgcaaaaaacaaaggaaagatctctcgaatgcta
gcagccaaaactgcattgactattcgttatgatgctcttggagaggactccagtgctgaa
atgggagctgagaacagattaaaagtagaaactagactgagacatttagaagagagaggg
ataagaagaataagtggcacaggaaaggccttggccagggcagacaaatatcagcacaga
agtgaagtgaaaacatatgacccctctggtgactctacactccctgctgttccaaaaaag
cgtaaaattgaagagatggaagaagggcagacggaggttacagtgaaagcaaagaagatc
aaagtagaaattatagaagaggaagatgtagaggaaagtgaaccagtcaaaaagaagaaa
aagaaaaaggaaaaaaaacaaagaatcgaggaagaggcagcttccactgaagagccatcc
actagcacagcaatggagagtacagagaaaaagaagaaaaagaagaaaatcaaaatagaa
caagaggactaa

DBGET integrated database retrieval system