KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102458153Help
Entry
102458153         CDS       T02980                                 

Gene name
GPX2
Definition
(RefSeq) glutathione peroxidase 2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00480  Glutathione metabolism
pss00590  Arachidonic acid metabolism
pss01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102458153 (GPX2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102458153 (GPX2)
Enzymes [BR:pss01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     102458153 (GPX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 102458153
NCBI-ProteinID: XP_014426581
Position
Unknown
AA seq 302 aa AA seqDB search
MAHVAKSFYDLSATDLHGEKVDFNNFRGRVVLIENVASLUGTTVRDYTQLNQLQARYPRR
LVVLGFPCNQFGYQVRGPPPPYPLPPQGALRVAGSSPSGTGSALGGLPPAGAWERGMYAA
PAPPVASCQSRAAAGAHMAGRSPALATQQHGAQSSLEISSRARERAAFCRAALHQDVGQG
HPRPSSCPLARHKQVSLASDVRPGGGFEPNFTLLQKCQVNGQDVHPVFAYLKAHLPAPAD
EPAALMADPKFLVWSPVRRDDLSWNFEKFLVGPEGEPFKRYSPRFQTSAIEPDIPRLLKL
AK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctcacgtcgccaagtccttctacgacctcagcgccaccgacctccacggggagaag
gtggatttcaacaacttccggggccgggtggtgctgatcgagaacgtggcgtctctctga
ggcacgacggtgcgggactacacccagctcaaccagctgcaggcccgctacccccgccgg
ctggtcgtgctgggcttcccgtgcaaccagtttggctaccaggtacgtgggccccctccc
ccatatcccctgcctccccagggagccctgcgggttgcaggatcatccccctccggcact
ggctcggcacttgggggactcccaccagctggggcctgggaacgggggatgtatgcagcc
cctgctcctcctgtggcgtcttgccagagcagagcagccgcgggtgcgcacatggcaggg
aggagcccagccctggccacgcagcagcatggtgctcagtccagcctggaaatcagttcc
agagccagggaacgggctgctttctgccgcgctgccttgcaccaggacgtggggcagggg
cacccccgccccagctcatgccctcttgcacggcacaagcaggtctcattagcctcagac
gtgcggccgggcggcggcttcgagcccaacttcacgctgctgcagaagtgccaggtgaac
gggcaggacgtgcaccccgtcttcgcctacctgaaggcccacctgcccgccccggccgac
gagcctgccgccctcatggccgaccccaagttcctcgtgtggagcccggtgcgccgcgac
gacctctcctggaacttcgagaagttcctggtggggcccgagggggagcccttcaagcgc
tacagcccccgcttccagaccagcgccatcgagcccgacatcccgcgcctcctcaagctc
gccaaatag

DBGET integrated database retrieval system