KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102459539Help
Entry
102459539         CDS       T02980                                 

Gene name
GSS
Definition
(RefSeq) glutathione synthetase isoform X1
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00270  Cysteine and methionine metabolism
pss00480  Glutathione metabolism
pss01100  Metabolic pathways
pss04216  Ferroptosis
Module
pss_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    102459539 (GSS)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102459539 (GSS)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    102459539 (GSS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pss04147]
    102459539 (GSS)
Enzymes [BR:pss01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     102459539 (GSS)
Exosome [BR:pss04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102459539 (GSS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSH_synth_ATP GSH_synthase MerR_1 Ribosomal_L19e U62_UL91
Motif
Other DBs
NCBI-GeneID: 102459539
NCBI-ProteinID: XP_025037227
Ensembl: ENSPSIG00000013110
Position
Unknown
AA seq 454 aa AA seqDB search
MRRVVNYAPLTLLPSAVPSTLFEQAYAVQQDFNLLVDAVSQNVGFLERALASTIRADDFT
AQLFKIYTQVLKEGLVQVSQRESSPSSPPFFPKGSLGTVFLGINRSDYMIDHGADGTPAL
KQIEINTIAASFGGLTSRTTAVHRHVLNVLGKSKEASKLLDNNPSKGIAAGIGRAWELYG
SARAVVMFLVEDTQRNIFDQRCIENELWTRNIRVIRRRFQEVFEKASLDKDRRLYMEGQE
VAVVYYREGYVPQNYNKQNWEARLLMERSKAVKCPDIATQLVGTKKVQQELSQPGALESL
LPDRPEAVARLRATFTGLYSLDMGEEGDRMVAMAIADPERFVLKPQREGGGNNLYGEELK
QLLEKIKDSPERTSYILMDKITPRPSLNCLLRAHSPLEISSCISELGVFGVYIRHGTDLV
VNRHVGHLLRTKAVEHADGGVAAGVAVLDTPYLV
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcggagggtggtgaactatgctcccttgacactgctcccctctgcagtcccaagcacc
ctctttgagcaagcctatgctgttcagcaagattttaacctacttgtggatgctgttagc
cagaatgtgggattcctggaacgtgctcttgctagcaccatcagggcagatgacttcaca
gcgcaactctttaaaatctacacgcaagtgctgaaagaagggctggtgcaggtatcccag
agggagtcttctccgtcctcccctcctttctttccgaagggaagtttggggacggtcttc
ttgggaataaaccgctctgattacatgattgaccatggtgcagatggcactccagcactg
aagcaaattgaaataaacaccattgctgccagcttcggaggccttacctcgagaaccacg
gctgtgcatcggcacgtattgaatgttttggggaagtccaaggaggcgtcgaagttactg
gacaataatccatccaaggggattgccgcaggcattgggagagcttgggagctctatggc
tcagccagagctgtggtgatgttcctggttgaagacacccaaaggaatatttttgaccaa
cgctgcatagaaaatgagctgtggaccaggaatatccgggtgatccggagacggtttcaa
gaggtgtttgaaaaggcgtctttggataaggacaggagattgtacatggaaggccaagag
gttgcagtggtgtattaccgagaaggctatgtgccacagaactataacaaacagaactgg
gaggcgcggttgttgatggaaaggtccaaagcggtgaagtgtcctgacatcgctacccag
cttgttgggaccaagaaagtgcagcaggagctgagccagccaggagccttggagagcttg
ctgcccgaccggcctgaggcagttgctcggttaagagcgacctttactggcctctattcc
ctggatatgggcgaagaaggtgacaggatggttgctatggccattgctgacccggagcgt
ttcgtgctgaagcctcagcgggaaggaggagggaacaacctctatggggaagagctcaag
caacttctggagaagatcaaagacagccccgagaggacctcctatatcctaatggataag
atcacacctcggccctcgctgaactgcttgctcagggctcacagccccctggaaatctcc
agctgtatctctgagctgggggtgtttggtgtctacatcaggcacgggacggacctggtt
gtgaataggcacgtcggtcacctcctgcgcaccaaggccgttgagcatgcagatggcggc
gtggcggctggggtggccgtactggataccccctatctggtgtga

DBGET integrated database retrieval system