KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102459619Help
Entry
102459619         CDS       T02980                                 

Gene name
NUDT12
Definition
(RefSeq) peroxisomal NADH pyrophosphatase NUDT12
  KO
K03426  NAD+ diphosphatase [EC:3.6.1.22]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00760  Nicotinate and nicotinamide metabolism
pss01100  Metabolic pathways
pss04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    102459619 (NUDT12)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102459619 (NUDT12)
Enzymes [BR:pss01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.22  NAD+ diphosphatase
     102459619 (NUDT12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NUDIX Ank_4 Ank_2 Ank_5 Ank_3 NUDIX-like zf-NADH-PPase Ank DZR
Motif
Other DBs
NCBI-GeneID: 102459619
NCBI-ProteinID: XP_006116180
Ensembl: ENSPSIG00000005800
UniProt: K7FE36
Position
Unknown
AA seq 459 aa AA seqDB search
MTNTERSPKQQMISQLHNFAATGDKVRLTALCSQSPSLINEAAENGWTALMYAARNGRFE
IVQILLEKGCDRSIVNKSSQTALDIAKFWGYKHIANLLENVKGGQKPFFLPNYVREYENY
FSRTLLDRRSDKRTDSKWLNRKQNHPATIYILFSNLSPLVTLGGGEDSYQQPEVRLCRLC
HKDVKEYMSQTEEVTLIFLGVELQLASLNGRVLKEDEDDGLVAWFALSIDATFAEQFKQK
HEDCYFLHPPMPALLQLPEREAGIVAQARSVLAWHNRYQFCPTCGSSTKIEEGGYKKTCL
KEDCPSLQGVHNTSYPRIDPVVIMQVLHPDGNQCLLGRQKRFPPGLFTCLAGFVEPGETI
EDAVRREVEEESGVKIGHVQYVSCQPWPMPSSLMIGCLAVAISTEIRVDKNEIEDARWFT
REQVVDVLIKGNQHSFLVPPSQAIAHQLIKHWIGMNANL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacactgaaaggagccccaagcagcaaatgatttctcagctacacaattttgct
gctactggagacaaggtcaggttgacagcactgtgtagtcagtctccatcccttatcaat
gaagctgctgagaatggttggacagccttgatgtatgctgcgagaaatggccgcttcgag
attgtgcagattcttcttgaaaaagggtgtgacaggtccattgtcaataaatcaagccag
actgcactggatattgctaaattttgggggtataagcatatagccaatttactagaaaat
gttaaaggtgggcagaagcctttttttctgccaaattatgtaagagaatatgaaaattat
tttagcaggacacttctggatagaagaagtgataaaagaacagattctaaatggttaaac
agaaaacaaaatcatccagctacaatatacatccttttctcaaatttaagccctttggtc
actttgggtggtggtgaagatagttatcagcagcctgaagtcaggctttgcagactgtgc
cacaaggatgtaaaggaatacatgagtcaaactgaagaagtcaccttgatatttcttgga
gtagaacttcagttggcttctctgaatggaagagttctgaaggaagatgaagatgatgga
ctggttgcttggtttgcccttagcatagatgccacctttgctgaacagtttaaacagaaa
catgaagactgttattttcttcatcctccgatgcctgcattgctgcagttgcctgaaaga
gaagctggcatagtagcccaggccagatctgtgctagcatggcataaccgataccaattc
tgcccaacatgtggcagctcaaccaagattgaagaaggaggctacaaaaagacttgttta
aaagaagattgtcctagcctccaaggtgttcacaatacatcatacccaagaattgatcct
gtagtgataatgcaagtccttcatccagatgggaaccagtgccttttaggcaggcagaag
aggtttcctcctggcttatttacctgccttgctggatttgtagagcctggggaaacaata
gaagatgctgttcgaagagaagtagaggaggagagtggagtcaaaattggtcatgttcag
tatgtctcttgtcaaccatggccaatgccctcctccttaatgattggctgcttagctgtt
gcaatatctacagaaattagagttgacaagaatgaaatagaggatgcccgttggttcact
agagaacaggttgtggacgttctcattaaaggaaaccagcattctttccttgtgccaccg
agtcaagctattgcacaccagttgataaaacactggattggaatgaatgctaacctttaa

DBGET integrated database retrieval system