KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102459956Help
Entry
102459956         CDS       T02980                                 

Gene name
WNK4
Definition
(RefSeq) serine/threonine-protein kinase WNK4
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pss01001]
    102459956 (WNK4)
   01009 Protein phosphatases and associated proteins [BR:pss01009]
    102459956 (WNK4)
Enzymes [BR:pss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102459956 (WNK4)
Protein kinases [BR:pss01001]
 Serine/threonine kinases: Other
  Wnk family
   102459956 (WNK4)
Protein phosphatases and associated proteins [BR:pss01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102459956 (WNK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OSR1_C Pkinase
Motif
Other DBs
NCBI-GeneID: 102459956
NCBI-ProteinID: XP_025041726
Position
Unknown
AA seq 795 aa AA seqDB search
MKPNSFYKVKVPELKEIIEGCIRMNKAERYTIQDLLEHAFFQEDTGVHVELAEEDDGVKS
GLKLWLRMDDTKKLHGKYKDNNAIEFLFELHKDVAEQVAQEMVTLGFVCEADYKLVAKAV
RDRVATIKRKREKMKRAQDELQRQEQEKQPGLLHLMEELKGPPGLSSAQPSPATPGSGDS
AFPPEPEEPEVDQHQHFLYRHTSYSSTTCTQAAPGAGATRVVAGAGMAGAGQHLPGGHPF
SLASAAGLEHVRAEAAAPGPLLGMGSRTCSSAELQLQELSRSVSSSSSLSGAGPLGQSEL
SPVQPSLGSSPSDSDLFSLADTPPVAQPGGLQPLLPVAMPGSPSTAAWSWPSFSMAPSLV
PYRLPTSPSFPQTAGPQAGGSLLPTTPPGAGLSTPATPPWSPVTSPLISLAEMFSLAMMS
MAHTLLPTVTVAAAPPGGPQAPAPIPRPQALYLGPAHFTSPDPAGLLEPAPCCNGTQDPH
STPAWEPAPAPQSLGRGGTRGSLLSSERAPAAGVLASSSVSPSSPKPGSHLIVSESPAPG
PAKARLSPINEETKPQILGRFQVTTSKDPANSQQQSPSDSEQSSPELWEGAAGASLQPST
SSSSSTEGSTSHDSDSVPDTPVQDPEELLAEEGTPVALAESDQEGVGAAGAESPQQAVVS
QVWMSYTRSMSYLSSDDTESEDEEIWEELQSLRQKHLSEVQTLQAVQKKEMEELYCRMGK
QPPPGIVSPAPMLSSRQRRLSKGGFNPSRRNSLQRLELSQPPGIMRRNSLSGSSTGSQEQ
RPTRGVTFAGDLSRM
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccaacagcttctacaaggtgaaggtgccagagctaaaggaaatcattgagggc
tgcatccgcatgaacaaggcggagaggtacaccatccaggacctgctggagcacgccttc
ttccaggaggacacgggggtgcacgtggagctggccgaggaggacgacggggtcaagtcc
ggcctcaagctctggctgcgcatggacgacaccaagaagctgcacgggaagtacaaggac
aacaacgccatcgagttcctcttcgagctgcacaaggacgtggccgagcaggtggcccag
gagatggtgaccctgggcttcgtgtgcgaggcggactacaagctggtggccaaggcagtg
cgggaccgtgtggccaccatcaagcgcaagcgggagaagatgaagcgggcgcaggacgag
ctgcagcgccaggagcaggagaagcagccggggctcctgcacctgatggaggagctgaaa
gggcccccaggactcagcagcgcgcagccctcgccggccacgcctggctccggggactct
gccttccccccggagcccgaggaacccgaagtcgatcagcaccagcacttcctgtaccgg
cacaccagctactcctccaccacctgtacgcaggcagcgcccggcgccggggccacgagg
gtggtggctggtgctggcatggctggggctggccagcatctccctgggggacatcccttc
tcattggcatctgcagctggcctggagcatgtcagggcagaggcagctgctcctggtcct
ctcctggggatgggatccagaacctgcagctccgcagagctgcagctgcaggaactctcc
cgctccgtctcgtcgtcgtcctcgctcagcggcgccggcccccttggccagtcggagctg
tctccagtgcagccctcgctcggcagctccccctccgacagcgacctcttcagcctcgca
gacaccccgccggtggcccagcctggggggctgcagcctctactcccagtagcaatgcca
ggctcccccagcacagccgcatggagctggccctccttctcgatggcgcccagcctggtc
ccgtaccggctgcccacgtccccgtcgttcccacagactgctgggccccaggctgggggc
tccctgctgcccaccacgccgcccggggccggactgagcacgcctgctacgcccccctgg
tctcctgtcacctcccccttgatctcgctggctgagatgttctccctggcaatgatgagc
atggcccacacgctgctgccgaccgtcaccgtggctgctgccccgccgggcgggccccag
gcccctgcgccgatacctcgcccgcaggccctgtacctggggccggcgcacttcacctcg
cctgaccccgcgggcctcctggagccagcgccgtgctgcaatgggactcaggacccccac
agcacccccgcctgggagccagctcctgcccctcagagcctcggaaggggcggcaccagg
gggagcctgctgtcatcagagagagcccctgccgctggggtgctggccagcagctcggta
tcacccagctccccgaaacccggcagccacctgatcgtctcggaatcgcctgcccctggc
ccagccaaggcccggctgtcccccatcaatgaagagaccaagccccagattctgggccgg
ttccaggtgaccacgtccaaggacccagccaacagccaacagcagagcccgagcgacagt
gagcagagcagcccggagctctgggagggggcagccggcgcctccttgcagccctccacg
tccagctcctcctccacggagggcagcacgagccacgactcggactctgtccctgacacc
ccggtgcaggacccggaggagctgctggccgaggaggggacgccggtggccctggcggag
agcgaccaggagggggtgggggcggccggggctgagagcccgcagcaggcagtggtgagc
caggtgtggatgagctacacccgcagcatgtcctacctgagcagcgacgacacagagagc
gaggacgaggagatctgggaggagctgcagagcctgcgccagaagcacctctcggaagtg
cagacgctgcaggctgtgcagaagaaggagatggaggagctgtattgccgcatggggaag
cagccgccccccggcatcgtctccccagctcccatgctctccagccgccagcgacgcctc
tccaaggggggcttcaacccgtctcgccgcaacagcctgcagcgcctcgagctctcgcaa
cccccagggatcatgcgcaggaactcgctgagtggcagcagtaccggctcgcaggagcag
cggccgaccagaggggtgacgttcgccggagatctcagccgaatgtaa

DBGET integrated database retrieval system