KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102460136Help
Entry
102460136         CDS       T02980                                 

Gene name
PIK3CG
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
  KO
K21289  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00562  Inositol phosphate metabolism
pss04261  Adrenergic signaling in cardiomyocytes
pss04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:pss00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102460136 (PIK3CG)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    102460136 (PIK3CG)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102460136 (PIK3CG)
Enzymes [BR:pss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102460136 (PIK3CG)
Membrane trafficking [BR:pss04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102460136 (PIK3CG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 DUF4135 Myc-LZ
Motif
Other DBs
NCBI-GeneID: 102460136
NCBI-ProteinID: XP_006133667
Ensembl: ENSPSIG00000006087
UniProt: K7FEW9
Position
Un
AA seq 1106 aa AA seqDB search
MELGNYEQRVVMREENKRRRRRMKPFSAASNLSSMELIAIEFILPTSNKHTKVPETMILE
IAGNCTVEQMKAQIWMRAIETSQTTDFYHKFTPDQCILQYQKKGQWYEIYDKHQVIQTLD
CILYWKVLQKKVGKIYVIQKQNPTEVVQEFQSQLNDLIGYDVTDVSNVHDDELEFTRRRL
VTPRMIEVACRDPKLYSMHPWITSKPLPEYVFKKITNNNIFIIIHRGTTSQKIKVSIDDT
PDMILQSFFTKMAKKKSLMDIPEDHSELDFVLRVCGRDEYITGETPVKDFHWIRQCLKNG
EEIHLVLDDPPDPKEDEVQKEEWPLVDDCTGVTGYHEQLTIDGKDHERVFTISLWDCNRK
FRVKIVGIDIPVLPRNTELTVFVEANIQHGQQLLSQRRTTSKPFTEEVLWNTWVEFDIKI
KDLPKGALLNLQIYCGKAQALSTKATIQSHDSPNSESKCKTQLLYYVNILLIDHRSLLRS
GEYVLHMWKISGKGEEQGSINADKLTSATNPDKENSMAISIVLDKYCHPIALPKHRITSD
PQGDRTRAEMPNQLRKQLEAIIDTDPLNPLTPEDKELLWHFRYESIKHPKAYPKLLSSVK
WGQQEIVSKTYQLLAKREAWDHSTLDVGLTMQLLDCNFSDENVRAMAVQKLESLEDDDVL
HYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSMHYQQRFAVIL
EAYLRGCGKAMLHDFMKQVQIIKLLHKVTMDIKSVSAEKYDVTAQVITQLKQKLEKLQNS
KLPESFRVPYDPGLRAGTLVIEKCKIMASKKKPLWLEFKCADPTALSNETIGIIFKHGDD
LRQDMLILQILRIMESIWEAESLDLCLLPYGCISTGNKIGMIEIVKDATTIAKIQQSTVG
NTGAFKDEILNQWLKERCVIEEKFQKAVERFVYSCAGYCVATFVLGIGDRHNDNIMITET
GNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTAGKKTSLHFHKFQDICVKAY
LALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIREALTVGKNEEDAKKHFLDQIEVCRD
KGWTVQFNWFLHLVLGIKQGVEKHSA
NT seq 3321 nt NT seq  +upstreamnt  +downstreamnt
atggagttggggaattatgaacagcgggttgtaatgagagaggaaaacaaacgaaggaga
agaagaatgaagcctttcagtgcagcaagtaatttgtcttcaatggagctgatagccatt
gaattcattctgcctacaagcaataaacatactaaagtgccggaaacaatgatactcgaa
atagctggcaactgtactgttgagcaaatgaaagcacagatttggatgcgtgcaatagag
acaagccaaaccacagatttttaccataaattcactccagatcaatgtattcttcaatat
caaaagaaaggacagtggtatgaaatttatgacaaacatcaggtaatacagactttggac
tgcatactgtactggaaagtgttacagaaaaaagtaggcaaaatctatgttatccagaag
caaaacccaacagaggtagttcaggaatttcagtcacagcttaatgatttaattggctat
gatgtcactgatgttagtaatgtgcatgatgatgagctagaatttactcgtcgcagatta
gtcacaccacgaatgattgaagtagcctgcagagatccaaaattgtattcaatgcatcca
tggattacgtccaaaccactcccagaatatgtatttaaaaagattactaataacaatatt
tttataatcatacatagaggaacaactagccagaaaattaaagtatcaattgatgacact
ccagatatgatccttcagagctttttcaccaaaatggcaaagaagaaatctttgatggat
attcctgaggatcacagtgaactggattttgttctccgggtttgtggcagagatgagtat
atcacaggagagacgccagtcaaagattttcactggataaggcagtgcctgaagaatggg
gaagagatccacctagtattagatgatcctcctgacccaaaagaggatgaggttcagaaa
gaagaatggcctttggtggatgactgcacaggtgtcacaggatatcatgaacagctgaca
atagatggaaaagatcacgagagggtgttcactatctctttgtgggactgtaacagaaaa
ttcagggtcaagatagttggcattgatatcccggtactaccaagaaatactgaacttact
gtgtttgttgaggctaatattcaacatggccaacagcttctttcacagagaagaaccaca
tctaagccttttactgaggaggttctatggaatacttgggttgaatttgatattaaaatt
aaagatttgcctaaaggagcactactcaatctacagatatattgtggcaaagcacaggca
ttatctacaaaggctaccatccagtcgcatgattcccccaactctgaatctaaatgcaaa
acccagctactctattatgtaaatattttgttgattgatcatcgttctttgctacggagt
ggggagtatgtgcttcatatgtggaagatttcagggaagggggaagagcagggaagcatc
aatgctgacaaacttacatcagcaaccaatcctgataaagaaaactcaatggctatctcc
attgttctggataaatattgccacccaatagctttgcccaaacatagaataacatctgac
ccccaaggggataggacaagagctgaaatgcccaatcagcttcgcaaacagcttgaggca
atcatagacactgacccacttaatccacttacacctgaggataaagaattactgtggcat
tttagatatgaaagcataaagcaccccaaggcgtatcctaagctgcttagctcagtgaag
tggggacagcaagaaatagtgtccaaaacataccagttgttagctaaaagagaagcttgg
gatcatagcactttggatgttggactaacaatgcaacttttggactgtaacttttcggat
gaaaatgtaagagcaatggcagttcaaaagttggagagcttagaagatgatgatgttctg
cattaccttttgcaactagtgcaggctgtgaagtttgaaccctatcatgacagcgcactg
gccagatttctactaaaacgtggtttgagaaacaaaagaatcggtcactttttattttgg
tttttaagaagtgagattgctcagtccatgcactaccagcagcggtttgctgtgatccta
gaagcctatcttaggggctgtggaaaagccatgctacatgatttcatgaaacaggttcag
ataattaagttgctgcataaagtcacaatggatataaaatcagtttctgctgaaaagtac
gatgtcaccgctcaagttatcacccagctgaaacaaaaacttgaaaaactgcagaacagc
aaacttccagaaagctttagagttccatatgacccggggctgagagcaggaacacttgtg
attgaaaaatgcaaaataatggcatccaagaaaaagccactttggcttgaatttaaatgt
gcagaccccacagccttatcaaatgaaactataggcattatcttcaaacatggagatgac
cttcgccaggatatgctcattttacagattcttcgaattatggaatctatttgggaagca
gaatctctggacctgtgtttgttgccatatggttgcatttctacaggaaataaaatagga
atgattgaaattgtgaaagatgctacaacaattgccaaaattcagcaaagcacagttggc
aatacaggtgcatttaaagatgaaatactaaatcagtggctgaaagaaagatgtgtgatt
gaagaaaagtttcagaaagcagtggaaagatttgtttattcttgtgctggttactgtgtg
gcaacgtttgtacttggaataggagacagacacaatgacaacattatgattacagaaaca
ggaaatctttttcatattgactttggccatattctggggaattacaaaagcttcctcgga
attaataaggaaagagtcccttttgtgttaacaccggattttctttttgtcatgggaact
gctggaaagaagacaagtctgcatttccataaatttcaggacatttgtgtaaaggcttat
ctagctcttcgacatcacacaaacctgctgatcattctgttttccatgatgctaatgact
ggaatgccccagttaaccagcaaagaagatattgaatatatccgggaagccctgactgta
ggtaaaaatgaagaagatgctaaaaagcatttcctggatcagattgaagtttgcagagat
aaaggctggactgtacagtttaactggtttctacaccttgtgcttggaatcaaacaagga
gtagaaaaacattctgcctaa

DBGET integrated database retrieval system