KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102462090Help
Entry
102462090         CDS       T02980                                 

Gene name
ABHD12B
Definition
(RefSeq) protein ABHD12B
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pss01002]
    102462090 (ABHD12B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pss04147]
    102462090 (ABHD12B)
Enzymes [BR:pss01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102462090 (ABHD12B)
Peptidases [BR:pss01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   102462090 (ABHD12B)
Exosome [BR:pss04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   102462090 (ABHD12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Abhydrolase_3 Thioesterase Peptidase_S15 Lipase_3
Motif
Other DBs
NCBI-GeneID: 102462090
NCBI-ProteinID: XP_006116364
Ensembl: ENSPSIG00000005673
UniProt: K7FDN9
Position
Unknown
AA seq 335 aa AA seqDB search
MNGAYLPFRSRSSRLFSTLVLHLLVIYVSVPFLVRLFPALLNKFVFLNILAFPFVELGKP
ELWLNHTVNFYLSPEPEVSIGVWHVLPASRGTEAQGKDHSWYEEALADDNPVIIYLHGSG
GNRASGHRVSLMKALSGAGFHILALDYRGYGDSTGYPSETGFTTDALFLYDWVKAHSGNS
TVAVWGHSLGSGVATNVARKLLEERGNQVDLIVLESAYTNIREAAAHIPFTKIYRQFPGF
EYLVLDSMALGDMYFRSDENVKVLSSPLLILHAEDDPVLPAHLGQKLFEIALAAYENKDQ
VRLVSFPEQLGFAHENICSHPELPDIVKDFLKKFK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaacggggcttatttgcctttcaggagtcggtcgtcccggttattcagcaccctagtc
ctgcatctcctcgttatttacgtctccgtaccattccttgtgcgtctctttcctgcgctg
ctgaacaagtttgtctttctcaatatcctggccttcccctttgtggaacttgggaagccg
gaattgtggctgaaccacactgtcaacttctatctcagccccgagccggaggtctccatt
ggcgtgtggcatgtgttgcctgccagcagggggacagaggctcaagggaaggaccacagc
tggtatgaagaagctcttgcagacgataatccggttataatttatctccacggcagtgga
ggcaacagggcttctgggcacagagtttccttgatgaaggcgctgagcggtgccggcttc
cacatcctggctctcgactacagagggtacggggactccactggctaccccagtgagacg
ggattcaccacagatgccctgttcctctatgactgggtaaaagcccacagcggaaatagc
accgtggccgtctggggacattccttggggagcggggtagccacaaatgtggcaagaaaa
ctgcttgaagaaagaggcaaccaggtggacctgatcgttctggaatctgcctacaccaac
attcgggaggcagccgctcacatccccttcaccaaaatctaccgccagttcccagggttc
gagtacctcgtcctcgactccatggccctgggggacatgtatttccgcagcgacgaaaat
gttaaagtgctctccagtcccctcttgattctgcatgcggaagatgatcccgtcttaccc
gcccacctgggtcaaaagctcttcgagattgcgctcgccgcctatgagaacaaagaccag
gtccggcttgtttcctttccggagcagctgggcttcgcccacgaaaacatctgttcccac
ccagagctgcctgacatcgtcaaagacttcctgaagaagttcaagtga

DBGET integrated database retrieval system