KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102463378
Entry
102463378         CDS       T02980                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pss01002]
    102463378 (ERAP1)
Enzymes [BR:pss01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     102463378 (ERAP1)
Peptidases and inhibitors [BR:pss01002]
 Metallo peptidases
  Family M1
   102463378 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 102463378
NCBI-ProteinID: XP_006118750
Ensembl: ENSPSIG00000007224
Position
Unknown
AA seq 950 aa
MPASFFTLPVADKSSFMMIMMMIGVLNVAVSVNNNQNSENRATVDVVSGSGSKQFPWDKI
RLPSHVIPVHYDLLLHPNLTTLTFTGFTRIEITVYQQTSSVILHSKNLQIIRATIQKRVG
NSHTEKEVRVLEYPPFEQIALLTAEPLHVGQNYTVSIEYAANLSESFHGFYKSTYRTQEG
EVRVLASTQFEPTAARMAFPCFDEPSFKARFSIKIKRDPKHLALSNMPIVKSVSVADWLV
EDHFDVSVKMSTYLVAFIVSDFKSVSKMTTSGIKISVYTVPDKINQADYALDAAVKLLEF
YENYFSIPYPLPKQDLAAIPDFQSGAMENWGLTTYRESALLYDPEKSSASNKLWITMIIA
HELAHQWFGNLVTMEWWNDLWLNEGFAKFMEYVSVSITHPELKVEDYFLGKCFNAMEVDA
LNSSHPVSTPVEDPAQIQEMFDDVSYEKGACILNMLRDYLNADVFKAGLVQYLRKYSYQN
TKNEDLWNSLAHTCPMGDTDESQLQGDSFCARNQQTSSSAHWTRREILDVKTMMNTWTLQ
KGFPLVTVTVKGKNVHLQQEHYMKGSDSSSSTGYLWHVPLTYITSKSDTVQRFLLTTKTD
VLILPEEVEWIKFNVGMNGYYIVHYEDDGWDALISLLKENHTAISSNDRASLINNVFQLV
SIGKLSISKALDLSLYLKHESQIMPVFQGMDELILMYKLMEKRDMDDIENQLKGYIVNLF
KDLIDKQTWNDEGSVSERMLRSSLLLFACVRKYQPCVDKAEEYFFKWKDSNGTLRLPSDV
KTAVYAVGAQTVEGWDFLFSKYRLPWFNTDRSQIEVALSITRNKDKLQWIMDQSLLGDVV
KTQDLPHIIIYVAKNPSGYHLAWTFLKENWNKLVQKFDLGSPSLAHMVIGVTNQYSTKEQ
LAEVKGFFSSLEEKSSQLRCIQQAIETIEENIRWMDINLEKIKIWLQNNL
NT seq 2853 nt   +upstreamnt  +downstreamnt
atgccagcctcattctttactctgccagttgcagataaatcctctttcatgatgataatg
atgatgataggtgttttaaatgttgcagtttctgtgaataataaccaaaatagcgaaaat
agggcgacagttgatgtagtgtctggaagtggaagcaaacagtttccttgggataaaata
aggcttccatcacatgtcatcccagtgcattacgatcttctcctccatccaaatcttacc
actttgacatttactggatttaccagaatagagattacagtataccaacaaactagttca
gtaattttgcacagcaagaatttgcaaattatcagggctaccattcaaaagagagtggga
aatagtcacactgaaaaagaagtgagagttttggaatacccaccatttgagcagattgcc
ctcctgacagctgaaccactgcatgttggacaaaactacactgttagcattgaatatgct
gcaaatctgtcagagagtttccatggtttttataaaagcacctatagaacccaggaagga
gaagtgagggtacttgcatcaacacagtttgagccaacagctgctcgaatggcttttcca
tgttttgatgaaccatcctttaaagccagattttcgattaagattaagagagatccgaag
catcttgcactatctaatatgccaatagtgaaatctgtcagtgttgctgattggcttgtt
gaagaccattttgatgttagtgtaaagatgagcacttatctagtggcctttattgtttcg
gattttaaatcagtcagcaagatgaccaccagtggaattaagatatcggtatatactgtc
ccagacaagatcaaccaagctgattatgccttggatgcagcagtgaaacttttagaattc
tatgagaattacttcagcattccatatcccttacccaaacaagatctagctgctattcct
gattttcagtctggagcaatggaaaactggggactgactacatacagggaatctgctttg
ctatatgaccctgaaaaatcctcagcatcaaataaactttggattactatgatcatagcc
catgagttggctcaccagtggtttggaaatctagttaccatggaatggtggaatgatctt
tggctaaatgaaggatttgcaaagtttatggagtatgtgtccgtcagtataactcatcca
gagctgaaagttgaagattattttttaggcaagtgttttaatgccatggaggtggatgca
ttaaattcctcacatcctgtttcaactcctgtggaagatccagctcagattcaagaaatg
tttgatgatgtttcatatgaaaagggagcttgtattttaaacatgttaagggattacttg
aatgcagatgtgtttaaagctggtcttgtacaatatctgcggaagtacagctatcagaat
acaaaaaatgaagatctatggaatagtctggcacatacttgtcctatgggtgacactgat
gaaagccaactacaaggtgatagcttttgtgccagaaaccaacaaacatcctcaagtgca
cattggaccaggagagagattcttgatgtgaagacaatgatgaacacttggactttacaa
aagggtttcccactagtaactgtcacggtaaaagggaagaacgtccatctgcagcaagag
cactatatgaagggatcagattcttcttcatcaacagggtacttgtggcatgttcccttg
acatacattactagtaaatctgacaccgtgcaaagatttttgctgacaactaaaacagac
gtcctcattctcccagaagaggtggaatggataaaattcaatgtgggaatgaatggttat
tacattgtgcactatgaagatgatggatgggatgctctcattagccttttaaaagaaaac
catacagcaattagcagcaatgatagagcaagtctcattaacaatgtattccagcttgtg
agtattggaaaactatcaatttctaaagctcttgatttatctttgtatttgaaacatgaa
tcccaaattatgcctgtatttcaaggtatggatgagctgattcttatgtacaagctcatg
gagaaaagggatatggatgatatagaaaatcagttaaagggatacatagtcaatcttttt
aaagacctaattgacaaacagacctggaatgatgaaggctcagtgtctgaaagaatgctt
cgcagttcgctcctcctgtttgcatgtgtgcgcaaataccagccatgtgtggacaaagca
gaagaatatttttttaaatggaaggactccaatggaactttacggttgcccagtgatgtt
aaaactgcagtatatgctgttggagcccagacagtcgaaggttgggacttcctttttagt
aaatataggctaccttggttcaacactgacagaagtcagattgaagttgctctaagtatt
accagaaataaggacaaacttcagtggataatggatcaaagtttgttgggtgatgtggta
aaaactcaggatcttccacatatcattatatatgttgctaaaaacccatctggctatcat
ctagcatggacatttttgaaggaaaactggaataaacttgtacaaaagtttgatcttgga
tcaccttctttagcacacatggtaatcggagtgacaaatcaatattctacaaaggaacag
cttgcagaggtgaagggatttttcagttctctggaagaaaaaagttcacagctccgctgt
atccaacaagctatagaaaccattgaagaaaatatacgatggatggacataaatttggaa
aaaatcaaaatatggttacagaataacctgtga

DBGET integrated database retrieval system