KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 112547288Help
Entry
112547288         CDS       T02980                                 

Definition
(RefSeq) cytosolic phospholipase A2 gamma-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00564  Glycerophospholipid metabolism
pss00565  Ether lipid metabolism
pss00590  Arachidonic acid metabolism
pss00591  Linoleic acid metabolism
pss00592  alpha-Linolenic acid metabolism
pss01100  Metabolic pathways
pss04010  MAPK signaling pathway
pss04217  Necroptosis
pss04270  Vascular smooth muscle contraction
pss04370  VEGF signaling pathway
pss04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    112547288
   00565 Ether lipid metabolism
    112547288
   00590 Arachidonic acid metabolism
    112547288
   00591 Linoleic acid metabolism
    112547288
   00592 alpha-Linolenic acid metabolism
    112547288
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112547288
   04370 VEGF signaling pathway
    112547288
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    112547288
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112547288
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112547288
Enzymes [BR:pss01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     112547288
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B Rap1a
Motif
Other DBs
NCBI-GeneID: 112547288
NCBI-ProteinID: XP_025044948
Position
Unknown
AA seq 179 aa AA seqDB search
MPYSAKENAPETMPNIAVLGSGGGLRATIALLGTLVEMKKQSLLDAAMYLCGVSGSTWCM
STLYKEKDWAENIEDLEGRLRDQLSKNFCDIIKKLNLAIQAAEDELFSLTDVWEIFFVYS
ILKLHDPTKLSQHTDASTKGTNPYPIYAGIEKSKFNKEHETSPGKEMWIFFIHLSCLSP
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgccctacagcgctaaggagaacgctccagagaccatgcccaatattgccgtgctagga
tcgggcgggggcctgcgggccaccattgcccttctgggaaccttggtggagatgaagaag
cagagcctgctggatgctgccatgtacctgtgcggggtgtcgggatccacctggtgcatg
tcaactctctacaaggagaaggactgggcagagaacatagaggacttggaaggacgcctg
cgagaccaactttccaagaatttctgtgatattataaaaaagttgaatttggcaatacag
gcagctgaagatgaactcttctctctgaccgatgtgtgggaaattttctttgtctatagt
atattgaaactgcatgatccgaccaagttatctcaacacacggatgcctccacaaaaggg
actaacccttaccccatttatgcaggaatagaaaagagcaaatttaataaagaacatgaa
acaagcccaggtaaagaaatgtggatttttttcatacacctctcctgtctctctccttaa

DBGET integrated database retrieval system