KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTOA0050Help
Entry
PSPTOA0050        CDS       T00118                                 

Gene name
traL-2
Definition
(RefSeq) traL protein
  KO
K12227  TraL protein
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Brite
KEGG Orthology (KO) [BR:pst00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pst02044]
    PSPTOA0050 (traL-2)
Secretion system [BR:pst02044]
 Type IV secretion system
  Icm/Dot secretion system protein
   PSPTOA0050 (traL-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 1187340
NCBI-ProteinID: NP_808708
UniProt: Q877T0
Position
pDC3000A:52006..52359
Genome map
AA seq 117 aa AA seqDB search
MKKSMCGALLMVVCCLPVVGNAAVCRSGQAASVGSQTAYERAKKASDVWAERERTVSDEL
QDCLSRIRTTSISLPSFPSLEDLMNQVADQVCQAAVDKINSHIPSGSDPWQSVGGSL
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaagcatgtgcggtgcactgctgatggttgtgtgctgcctgcccgttgtggga
aacgcagcagtgtgccgctcaggacaagcggccagtgtgggcagtcagactgcgtatgag
cgggccaagaaggcgtcggacgtgtgggcagagcgcgagcgcaccgtctcagacgaactc
caggattgcttgtcgcgcattcgcaccaccagcatcagccttccctcgtttccaagcctg
gaagacctgatgaaccaggtggccgatcaggtatgccaggcggcggtggacaagatcaac
agccatatccccagcggctcggacccttggcagtcggtaggaggttcattgtga

DBGET integrated database retrieval system