KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTOA0064Help
Entry
PSPTOA0064        CDS       T00118                                 

Gene name
traY-2
Definition
(RefSeq) traY protein
Organism
pst  Pseudomonas syringae pv. tomato DC3000
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NABP CDK2AP
Motif
Other DBs
NCBI-GeneID: 1187354
NCBI-ProteinID: NP_808722
UniProt: Q88BL1
Position
pDC3000A:63781..65925
Genome map
AA seq 714 aa AA seqDB search
MNLIKRFWWMGLLLVFSVPVLADNVDYQTIAAASQKPNDLSRQAMVMIMGQVAVDPFAPS
QPTLIGSLFAIINGVLAVMALFWFLTITLKTIVKAGHQGQFFAGGRSALYPIMTFAGFIM
ILPTQSGWSLAQLVMVWACSTMGVGSANLLTDKAVDMMDSGYSMVTQPTAPSTRSAARGI
FEMNLCKYAINRELESLYADGVANTPLITTKGGNGQYDTGNGSAVCGSAKTPNTGRTGTW
NLLFDSDVDTSGVITAQHQALDTMQSTLDQAAQAFVDTYLSKRDQDTGSFQDAETQIQNA
AAAYENTVNLALNKIDFKDTLQSQLSSQIKSSGWVALGSWYHTFATANNKTNDVASSTPV
VTGMSNLGEHGTGDLYNQVFAAYKSQVQNSTYTAPLGTQTTKDDGAAATANDPNAVFVGI
FKSPMQKLTSLFATGKIGTDASFSNQVNPLIKMQTIGDYTLGTVETLMVAYAGTWAAASS
ASNSPLGWGAKIFSVDVGAVVKDVLGALAPMFYFVMFALLAIGFSLAVFLPAVPFLFWMV
GIFNWVVSVLVGCAAGSMWAATHLGAEEDKGSRSTYGYIFLIDMMLRPSLMVLGFFFASV
AVIGGGTILNLLFASALANANADSIVGLFKMIGWLMIYARIATFGVTRLFGLQASLADYV
ISFLGGREGANLMGGMVDNMKGMFGAAGSGAQRTPGVKMQPRKPGAGGNGDGIQ
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcattaaacgcttctggtggatgggtcttctgctggtcttctccgtgccggta
ctggccgataacgtggattaccagacgatcgcggcagcctcccaaaagcccaatgacctc
tcgcgccaggcgatggtcatgatcatgggccaagtagcagtcgatccatttgcaccatca
cagccaaccttgattggctcactgttcgccattatcaatggcgttctggccgtgatggcc
ctgttctggtttctgaccatcaccctgaaaaccattgtgaaggctgggcatcagggacag
tttttcgcaggcggtcgatctgcgttgtacccgatcatgacgtttgccggtttcatcatg
atcttgcccacccaatcaggttggtcactggcccagctcgtcatggtatgggcctgctcc
accatgggggttggcagtgccaatctgctgactgataaagctgtggacatgatggacagc
ggctactcgatggtgacgcaacccacggctccttcaacccgaagcgcggcacggggcatc
tttgaaatgaacttgtgcaagtacgcgatcaaccgtgagctggagtcgctgtatgcggat
ggtgtggccaataccccgttgattaccaccaaggggggcaacggccaatacgacactggc
aacggcagcgcggtgtgtggttctgccaaaacacccaatacgggccgcaccggaacctgg
aacctgctgtttgacagtgacgtggacacgagtggggtgatcacggcgcagcaccaagcg
ctagacaccatgcaaagcaccctggatcaagcggcacaggcgttcgtagacacctacctg
agcaagcgcgaccaggatacggggagcttccaggacgccgagacgcagatccagaacgca
gccgccgcctatgaaaacacggtgaacctggccctcaacaagatagatttcaaggacaca
ctgcaaagccagttgtcgagccagatcaaaagcagtggttgggtggccctgggcagttgg
tatcacaccttcgccacagctaataacaagaccaacgacgtggccagctcgaccccggtt
gtcacggggatgagtaatctgggcgagcacggcaccggcgacttgtataaccaggtgttc
gcagcctacaaatcgcaggtgcagaacagtacctacaccgcgccgctggggacgcagacg
accaaggatgacggggcggcagcgacggcgaatgacccgaatgcagtgtttgttggcatt
tttaagtcgcctatgcagaagttaacctcgttatttgcaactgggaaaattggtactgat
gccagcttttccaaccaggtgaacccgcttatcaaaatgcaaaccattggtgactacacg
ctgggaactgttgaaaccctgatggtggcctatgccgggacgtgggcagctgcctcatcg
gccagtaattcgccgttgggctggggtgccaagatattttcggtggatgtcggggcggtg
gtgaaagatgtgctgggtgcgctggccccgatgttctatttcgtcatgttcgccctgctg
gccatcggtttttcgctggccgtatttctgcctgctgtgccctttctgttctggatggtg
ggcatattcaactgggtcgtcagtgtgctggtgggctgtgcggcgggctcaatgtgggct
gccacgcacctgggggccgaagaggacaaggggagtcgcagtacctacggttatatcttt
ctgatcgacatgatgctgcggccttcgttgatggtactggggttcttttttgcgtcggtg
gccgtaatcggtgggggaacgatcctgaatctgttattcgcctcggcgctggccaatgcc
aacgcggactcgatcgtgggattgttcaagatgatcggatggctgatgatctatgcccgc
attgcgacctttggtgtgactcgactctttggcctgcaggcgtccttggcggactacgtg
atctcgttcctgggcggtcgagaaggcgccaacctgatgggcggcatggtcgataacatg
aaaggcatgtttggtgctgctggctctggggcacaacgtacccctggcgttaaaatgcaa
cctaggaagcctggcgcagggggcaatggggatggaatccagtag

DBGET integrated database retrieval system