KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_0002Help
Entry
PSPTO_0002        CDS       T00118                                 

Gene name
dnaN
Definition
(RefSeq) DNA polymerase III subunit beta
  KO
K02338  DNA polymerase III subunit beta [EC:2.7.7.7]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00230  Purine metabolism
pst00240  Pyrimidine metabolism
pst01100  Metabolic pathways
pst03030  DNA replication
pst03430  Mismatch repair
pst03440  Homologous recombination
Module
pst_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pst00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PSPTO_0002 (dnaN)
   00240 Pyrimidine metabolism
    PSPTO_0002 (dnaN)
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    PSPTO_0002 (dnaN)
   03430 Mismatch repair
    PSPTO_0002 (dnaN)
   03440 Homologous recombination
    PSPTO_0002 (dnaN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pst03032]
    PSPTO_0002 (dnaN)
   03400 DNA repair and recombination proteins [BR:pst03400]
    PSPTO_0002 (dnaN)
Enzymes [BR:pst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PSPTO_0002 (dnaN)
DNA replication proteins [BR:pst03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     PSPTO_0002 (dnaN)
DNA repair and recombination proteins [BR:pst03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     PSPTO_0002 (dnaN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_beta_2 DNA_pol3_beta DNA_pol3_beta_3 HSP20
Motif
Other DBs
NCBI-GeneID: 1181610
NCBI-ProteinID: NP_789864
UniProt: Q88BK2
Position
1913..3016
Genome map
AA seq 367 aa AA seqDB search
MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVQGQQLSLTGTDLEVELVGRVQLE
EPAEPGEITVPARKLMDICKSLPNDALIDIKLDDSKLIVKAGRSRFTLSTLPANDFPTVE
EGPGSLTFNLVQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVSAGILRAVATDGHRLAMC
SMSADIEHADRHQVIVPRKGILEMARLLTEQDGMVSIVLGQHHIRATTGEFTFTSKLVDG
KFPDYERVLPKGGDKLVLGDRQSLREAFSRTAILSNEKYRGIRLQLANGQLKIQANNPEQ
EEAEEEIGVEYNGEALEIGFNVSYLLDVLSVMTTEQVRLILSDSNSSALVQESDNDDSAY
VVMPMRL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcatttcaccattcaacgcgaagccctgttgaaacccctgcaattggtcgccggcgtg
gtagaacgccgccagaccttgccggttctttccaatgtgcttctggtcgtgcaaggccag
cagctgtcgctgaccggtactgacctggaagtcgagctggttggccgtgttcagctggaa
gagcctgccgaacctggggaaatcaccgttcccgcgcgcaagcttatggacatttgcaaa
agcctgcccaatgatgcgctgatcgacatcaagcttgatgactcgaaactgatcgtgaag
gcaggtcgcagccggttcacgttgtccacgctgcctgccaacgatttcccgacggtggaa
gaaggccccggctcgctgacgttcaatctggtgcaaagcaaactgcgtcgcctgatcgag
cgcaccagctttgcgatggctcagcaggatgttcgctattaccttaacggcatgctgctt
gaagtcagtgccggaatcttgcgtgcagtggctaccgatggccaccgtctggcaatgtgc
tcgatgtcagccgatatcgaacacgccgaccgtcatcaggtcatcgtgcctcgtaaaggt
attctggagatggcgcgtttgctgaccgagcaggacggcatggtcagcatcgtgctgggt
cagcatcacatccgcgccaccaccggtgaatttacctttacctcgaaactggtcgatggc
aagttcccggattacgagcgtgtgttgcccaagggtggcgacaagctggtactgggcgat
cgtcagtccctgcgtgaagcgttcagccgcaccgcgattctgtccaacgagaagtaccgt
ggcattcgtctgcaactggctaacggccaactgaaaattcaggccaacaatcctgagcag
gaagaggcagaagaagaaatcggcgtcgagtacaacggtgaggcgttggagatcggtttc
aacgtgagctacttgctcgacgtgctgagcgtcatgaccaccgaacaggttcgcctgatt
ctctctgactccaacagcagcgctctggtgcaagagtcggataacgacgattccgcctac
gttgtcatgccgatgcgtctgtaa

DBGET integrated database retrieval system