KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_0631Help
Entry
PSPTO_0631        CDS       T00118                                 

Gene name
rplV
Definition
(RefSeq) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pst00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    PSPTO_0631 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pst03011]
    PSPTO_0631 (rplV)
Ribosome [BR:pst03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    PSPTO_0631 (rplV)
  Bacteria
    PSPTO_0631 (rplV)
  Archaea
    PSPTO_0631 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 1182251
NCBI-ProteinID: NP_790478
UniProt: Q889W6
Position
694575..694907
Genome map
AA seq 110 aa AA seqDB search
MEVAAKLSGARISAQKARLVADQIRGKKVGEALNLLAFSSKKAAEILKKVLESAVANAEH
NEGADVDDLKVSTVFVNEGRSLKRIMPRAKGRADRIVKRSCHITVKVADK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagtagccgctaagttgtcgggcgctcgaatctccgcccagaaagcccgcttggtc
gccgaccagatccgcgggaagaaggtgggcgaagcgctcaacctgttggctttcagcagt
aagaaagccgccgagatcctgaagaaagtgctggagtcggctgtagccaacgccgagcat
aacgaaggcgcagacgttgatgacctcaaggtctccaccgtcttcgtcaacgaagggcgt
tcgctgaagcgcatcatgccacgtgctaaaggccgtgctgatcgcatcgtcaagcggtct
tgccatatcactgtcaaggttgctgacaagtaa

DBGET integrated database retrieval system