KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_0849
Entry
PSPTO_0849        CDS       T00118                                 

Definition
(RefSeq) hypothetical protein
Organism
pst  Pseudomonas syringae pv. tomato DC3000
SSDB
Motif
Pfam: TraU
Other DBs
NCBI-GeneID: 1182478
NCBI-ProteinID: NP_790689
UniProt: Q889B2
Position
complement(917806..918744)
AA seq 312 aa
MNLRKPSAWTALALSISTGPAAAGTVTSATLAASTLSPDCLEYKVVGICYWLLCTPFGCK
VKTSTKVRHYVPDAVVSSYSNTGENPWVEVSSLSSPTSFAQDGGDGTTSHNNEDNLAKFK
NTDVIGHPGGATFSKFASASGYACQGAATPYMPYLLSTLDTIAWRYGVPESAYPEALIPG
QREVGGLTSGDMWGSLYPRSGFIHQADDYKAAAVIAQRAGDVVTRRGQIHIYQPLLAKPQ
SGYWPAGELIETDASTGKWQELTPTLSQSCAVFPNSQPRVQATDGGYAWALWRPYSCCKR
QGQTFLGSTDFQ
NT seq 939 nt   +upstreamnt  +downstreamnt
atgaacctgcgcaagccttcggcatggacggccttggccctgtcgatctcgaccgggcca
gccgccgccggtacagtgacctcggccaccctcgccgcctcaaccctgtcgcctgactgc
ctggagtacaaggtggtcggcatatgctactggctgctctgcacgccgtttggctgcaag
gtcaagacgtcgaccaaggttcgacattatgttcccgacgcggttgtatcgagctactcg
aacactggggaaaacccttgggtcgaagtctcttcgctgagttcacccacttcattcgcc
caggatggcggcgacggaaccaccagccacaacaacgaagacaacctggccaaattcaaa
aacactgacgtcattggccaccccgggggagctacgttcagtaagtttgccagcgcttcg
gggtatgcctgtcagggtgctgcgaccccctacatgccttacctgctgagcacgctggac
accatcgcctggcgttatggtgttccagaatcagcctatcccgaagccctgattcccggt
cagcgagaggtgggcggtctcacctcgggggacatgtggggaagcctttatccccgtagt
ggttttatccatcaagccgacgattacaaggcagcggccgtgatcgcgcagcgcgctggt
gacgtggtcactcgccgcggtcagattcacatctatcaaccccttctggcaaaacctcag
tcaggctactggcctgctggggaattgatcgagaccgacgccagcaccggtaagtggcaa
gagctcacgccgaccctcagtcaaagctgtgcggtattcccgaactcgcagccccgtgtg
caggcgaccgatggcggttatgcctgggcgctatggcgaccctattcctgctgcaagcgg
caaggacaaacttttcttggcagtacggactttcaatga

DBGET integrated database retrieval system