KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_0850Help
Entry
PSPTO_0850        CDS       T00118                                 

Definition
(RefSeq) hypothetical protein
Organism
pst  Pseudomonas syringae pv. tomato DC3000
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1525 FAD-SLDH DUF4633 Thioredoxin_3
Motif
Other DBs
NCBI-GeneID: 1182479
NCBI-ProteinID: NP_790690
UniProt: Q889B1
Position
complement(918744..919160)
Genome map
AA seq 138 aa AA seqDB search
MAFLILIAAIQVPFANAETWIVTDRNHPVQAPARVRLILLDESERLEAKFSEGLPANQQQ
AIVIMQQRLKSADAQRLQRDQQNLVDAWSIGVTKVPAVVVDRTFVVYGETNVLAAEQRIA
QWRAAAHHQDEAGQGDIP
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggccttcctgatcttgattgcggccatacaggtccccttcgcgaacgcggagacgtgg
atcgttactgaccggaaccacccagttcaggcaccggcacgtgtccggctgatcctcctg
gacgaatcagaaaggcttgaggccaagttctctgaaggattgccagcgaatcagcagcag
gccattgtgatcatgcagcaacgcctcaagagcgccgatgcgcagcgcttgcaacgcgac
caacaaaacctcgtagacgcctggagcattggggtcacgaaggtcccagcagtggtggtc
gaccgcacgtttgttgtgtatggcgaaaccaatgttctggcggcggaacagcgcattgcc
cagtggcgtgctgctgcccaccatcaagatgaagctggccagggagatataccgtga

DBGET integrated database retrieval system