KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_0957Help
Entry
PSPTO_0957        CDS       T00118                                 

Gene name
phbA-1
Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00071  Fatty acid degradation
pst00072  Synthesis and degradation of ketone bodies
pst00280  Valine, leucine and isoleucine degradation
pst00310  Lysine degradation
pst00362  Benzoate degradation
pst00380  Tryptophan metabolism
pst00620  Pyruvate metabolism
pst00630  Glyoxylate and dicarboxylate metabolism
pst00640  Propanoate metabolism
pst00650  Butanoate metabolism
pst00900  Terpenoid backbone biosynthesis
pst01100  Metabolic pathways
pst01110  Biosynthesis of secondary metabolites
pst01120  Microbial metabolism in diverse environments
pst01130  Biosynthesis of antibiotics
pst01200  Carbon metabolism
pst01212  Fatty acid metabolism
pst02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSPTO_0957 (phbA-1)
   00630 Glyoxylate and dicarboxylate metabolism
    PSPTO_0957 (phbA-1)
   00640 Propanoate metabolism
    PSPTO_0957 (phbA-1)
   00650 Butanoate metabolism
    PSPTO_0957 (phbA-1)
  Lipid metabolism
   00071 Fatty acid degradation
    PSPTO_0957 (phbA-1)
   00072 Synthesis and degradation of ketone bodies
    PSPTO_0957 (phbA-1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSPTO_0957 (phbA-1)
   00310 Lysine degradation
    PSPTO_0957 (phbA-1)
   00380 Tryptophan metabolism
    PSPTO_0957 (phbA-1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSPTO_0957 (phbA-1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSPTO_0957 (phbA-1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSPTO_0957 (phbA-1)
Enzymes [BR:pst01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PSPTO_0957 (phbA-1)
Exosome [BR:pst04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSPTO_0957 (phbA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 1182586
NCBI-ProteinID: NP_790796
UniProt: Q888Q9
Position
complement(1038333..1039511)
Genome map
AA seq 392 aa AA seqDB search
MQDVVIVAATRTAVGSFQGSLAAVPAVDLGAAVIRQLLAQTGVDGALVDEVIMGQVLTAG
AGQNPARQAAIKAGLPFSVPAMTLNKVCGSGLKTLHLATQAIRCGDADIVIAGGQENMSL
SNYVLPGARTGLRMGHASMIDTMITDGLWDAFNDYHMGITAENLAQKYEISREAQDAFAA
LSQQKAIAAIEAGRFVDEITPILIPQRKGEPLSFATDEQPRAGTTAETLGKLKPAFKKDG
TVTAGNASSLNDGAAAVMLMSATKAEQLGLPVLAHIAGYANAGVDPAIMGIGPVSATRRC
LDKAGWSLDELDLIEANEAFAAQSLSVGKELGLDPQKLNVNGGAIAIGHPIGASGCRVLV
TLLHEMIRRDAKKGLATLCIGGGQGVALALAR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgtcgttatcgtcgccgccacccgcaccgccgtgggcagtttccagggttca
ctggccgccgtcccagctgtcgatctgggcgcagcggtcattcgccaactgttggcccag
accggtgtggacggcgcgctggtcgatgaagtcatcatgggccaggtgctgaccgctggc
gctggccagaatccggcacgccaggccgctatcaaggcgggcctgcccttctccgtgccg
gccatgaccctcaacaaggtctgcggctcgggcctcaagacgctgcacctggcgacccag
gccattcgctgcggtgatgccgacatagtcatcgctggcggacaggaaaacatgagcctg
tccaattacgtcctgccgggcgcacgcaccggtttgcgcatgggccatgccagcatgatc
gacacgatgataaccgacggcctgtgggatgccttcaacgattaccacatgggcatcact
gccgaaaacctggcgcagaagtacgagatcagtcgtgaagcccaggatgccttcgcggcc
ttgtctcagcaaaaagccatcgccgctatcgaagccgggcgctttgtcgatgaaatcacc
ccgatcctgatcccgcagcgcaaaggcgagccgttgtccttcgccactgacgaacagccg
cgggcgggcaccacggctgaaacactcggcaaactcaaacccgccttcaagaaggacggc
accgtcacggcgggcaatgcatcgtcgctcaacgacggcgctgccgcagtgatgttgatg
agcgcgaccaaggcagagcagttgggcttgccggtactcgcgcacatcgcgggatacgcc
aacgcaggtgtcgacccggccatcatgggcatcggcccggtcagcgcgacccgccgctgc
ctggacaaggccggttggtcactggacgaactagacctgatcgaagccaacgaagcgttc
gccgcgcagtcgctgtcagtcggcaaagaattggggctggacccgcagaagctcaacgtc
aacggcggcgcaatcgccattggccaccccattggcgcatcaggctgccgcgtgctggtg
acgctactgcacgagatgatcaggcgtgatgcgaaaaaaggcctggccacgctgtgtatc
ggcggtggccagggtgttgccctcgcgctggcacgctga

DBGET integrated database retrieval system