KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_1289Help
Entry
PSPTO_1289        CDS       T00118                                 

Gene name
glk
Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00010  Glycolysis / Gluconeogenesis
pst00052  Galactose metabolism
pst00500  Starch and sucrose metabolism
pst00520  Amino sugar and nucleotide sugar metabolism
pst00521  Streptomycin biosynthesis
pst01100  Metabolic pathways
pst01110  Biosynthesis of secondary metabolites
pst01120  Microbial metabolism in diverse environments
pst01130  Biosynthesis of antibiotics
pst01200  Carbon metabolism
Module
pst_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSPTO_1289 (glk)
   00052 Galactose metabolism
    PSPTO_1289 (glk)
   00500 Starch and sucrose metabolism
    PSPTO_1289 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PSPTO_1289 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSPTO_1289 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PSPTO_1289 (glk)
Enzymes [BR:pst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PSPTO_1289 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-GeneID: 1182925
NCBI-ProteinID: NP_791118
UniProt: Q887K3
Position
1418302..1419267
Genome map
AA seq 321 aa AA seqDB search
MKLALVGDIGGTNARFAIWEDDTLHSVRVFPTIDYAGPEKAIEVYLQDLELQRGDIGYVC
LAVAGPVDGDLFQFTNSHWQLSREAFCADLKVDHLLLINDFTAMALGMTRLKDDEYLTVC
HGVGKPDRPRVVVGPGTGLGIGTLIKLEDSRWMALPGEGGHADLPIGTAREALLWTRLMA
EHEHVSAEVVLSGAGLLLLYQVSCALDGMDAELKSPAAITSAALAGDPVAAAVLEQFCVF
LGRVVGNNVLTLGSLGGVYIVGGVVPRFTEFFMNSGFKRAMGEKGVMSGYFKNLPVWLVT
AEYPGLMGSGVALQQAFGSQI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttggccctggtcggtgatataggcggtaccaatgcacgttttgccatttgggaa
gacgacacgctgcattctgtccgggtgttcccgaccattgactacgcaggccccgaaaag
gccatcgaagtctatctgcaggaccttgaattgcagcgcggtgacattggctatgtgtgc
ctggcggtcgccgggccggtcgatggcgatctgtttcagttcaccaacagccactggcaa
ctgagccgtgaggcgttctgcgccgacctgaaagtcgatcacctgctgctgatcaacgac
ttcaccgccatggcgctgggcatgacccggctcaaggacgatgaatacctgacggtctgt
catggcgtcggcaagccggatcgcccgcgcgtggtggtcgggccgggcactgggctgggc
atcggcacgctgatcaaactggaagacagccgctggatggccttgccgggcgagggcggg
catgccgacctgccaatcggcacggcgcgcgaggccctgctgtggacgcggctgatggcc
gagcacgaacatgtcagcgccgaagtggtgctcagtggtgcgggcctgttgttgctgtat
caggtcagttgcgcgctggacggcatggacgcagagctcaagtcgcctgctgcgatcacg
tcggctgcgctggcaggcgatccggtcgcggcggcggtgcttgaacagttctgcgtgttc
ctcggcagagtggtcggcaacaacgttctgaccctgggcagtctgggcggggtctacatc
gtgggtggcgtggtgccacgtttcacagaattcttcatgaacagcggcttcaagcgcgcc
atgggcgagaagggcgtgatgagcggctacttcaagaacctgccggtctggctggtcacc
gccgagtacccagggcttatgggttcaggcgttgcgctgcaacaggcgttcggttcgcaa
atttga

DBGET integrated database retrieval system