KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_1563Help
Entry
PSPTO_1563        CDS       T00118                                 

Gene name
pcm
Definition
(RefSeq) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Brite
Enzymes [BR:pst01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PSPTO_1563 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 RrnaAD Methyltransf_25 NodS Methyltransf_11 Methyltransf_23
Motif
Other DBs
NCBI-GeneID: 1183200
NCBI-ProteinID: NP_791388
UniProt: Q886L4
Position
1725268..1725903
Genome map
AA seq 211 aa AA seqDB search
MTSQRTRERLIQRLCEEGIANQRVLDVIRKTPRHLFVDEALAHRAYEDTALPIGHNQTIS
QPYMVARMSELLLAAGPLDKVMEIGTGSGYQTAVLSQLVERVFSVERIKGLQDRAKERLV
ELNLRNVVFRWGDGWEGWPALAPYNGIIVTAVATDVPQALLDQLAPGGRLVIPVGAGEVQ
QLMLIIREENGFSRHVLGAVRFVPLLNGPIA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgcagcgaacccgcgagcgcctgattcagcgtctgtgcgaagaaggcatcgcc
aaccagcgtgtgctggacgttatccgcaagacgccccggcacctgtttgtcgatgaagcg
ctggcgcatcgcgcctatgaagacactgcactgccaatcggtcacaaccagaccatttcc
cagccttacatggttgcgcggatgagcgagctgctgctggcagccgggccgctcgacaag
gtcatggagatcggcaccggttccggctatcagaccgccgtgctgtcgcaactggtggag
cgggtgttttcggtcgagcgcatcaagggccttcaggaccgcgccaaggaacggctggtc
gaactcaacctgcgcaacgtggttttccgctggggcgacggctgggagggctggccggcg
ttggcgccctacaacggtatcatcgtgacggcagtcgcgaccgatgtgccgcaggcgctg
ctcgatcaactggcccccggaggccggctggtcataccggtgggggctggcgaggttcag
caactgatgctgatcattcgtgaagaaaacggtttttcccggcatgtactcggcgctgtg
cgcttcgtcccgctgctcaatgggccgattgcgtaa

DBGET integrated database retrieval system