KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_1993Help
Entry
PSPTO_1993        CDS       T00118                                 

Gene name
hemN
Definition
(RefSeq) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00860  Porphyrin and chlorophyll metabolism
pst01100  Metabolic pathways
pst01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pst00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PSPTO_1993 (hemN)
Enzymes [BR:pst01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     PSPTO_1993 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C Viral_DNA_Zn_bi
Motif
Other DBs
NCBI-GeneID: 1183638
NCBI-ProteinID: NP_791816
UniProt: Q884U3
Position
complement(2177061..2178443)
Genome map
AA seq 460 aa AA seqDB search
MLDAIRWDSDLIHRYDVAGPRYTSYPTAVQFDTRAGAFELLHALRESRKARRPLSLYVHI
PFCANICYYCACNKVITKDRGRAQAYLQRLEHEIRMLACHLAPSQVVEQLHLGGGTPTFL
SHDELRRLMARLRAHFTLLEDDSGDYGIEIDPREADWASMGLLRELGFNRVSLGVQDLDP
TVQRAINRMQSLEETRAIVEAARTLQFRSVNIDLIYGLPRQTPQGFSRTVDEIIELQPDR
LSVFNYAHLPERFMPQRRIDASDLPDAHTKLLMLERTVEQLTDAGYRYIGMDHFALPDDE
LAIAQEELTLHRNFQGYTTHGHCDLIGLGVSAISQVGDLYSQNSSDLNDYQRLLDSDQPA
TLRGLICSEDDRIRRAVIQQLICHFTLNFSELEKAFAISFRDYFADAWPQLLCMADDGLI
TLSDSAIEVRPAGRLLVRSVCMVFDAYLTRQNRQQFSRAI
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacgccattcgttgggattcagacctgatccatcgctacgatgtggcaggaccg
cgctacacgtcttatccgaccgccgtgcaatttgatacccgggcaggcgcattcgagctg
ctgcacgccctgcgggaaagtcgcaaggcgcggcgtccgttgtcgctttacgtgcacatc
ccattctgcgcaaatatttgctactactgtgcgtgcaacaaagtgatcaccaaggatcgc
ggccgggcacaggcttacctgcagcggcttgaacacgaaatccggatgcttgcctgccat
ctggcgcccagccaggtggtcgagcaactgcacctgggcggcggcacaccgaccttcctc
agccatgatgaactgcgtcgcctgatggcccggttgcgcgcgcatttcacgctgctggag
gatgattccggcgactatggcatcgagatcgacccgcgcgaagcggattgggcaagcatg
ggtctgctgcgcgaactgggtttcaaccgggtcagccttggcgtgcaggaccttgacccg
acagtgcaacgggcgatcaaccgcatgcagagcctggaagaaacccgcgccatcgtcgag
gccgcacgcacgttgcaatttcgctcggtgaacatcgacctgatctacggcctgcccaga
caaaccccgcaagggttcagccgcacggtggacgaaatcatcgagttgcagcctgatcgg
ctgtcagtgttcaactacgcccatctgccggaacgcttcatgccgcagcggcgcatcgac
gcgtcggacctgccggatgcgcacaccaagctactcatgctggagcgtaccgtcgagcaa
ctgaccgacgcaggttaccggtacatcggaatggaccacttcgccctgcccgatgacgag
ttggccatcgctcaggaagaactgaccctgcaccgcaactttcagggctacaccacgcat
ggccactgcgacctgatcgggctgggggtttcggccatcagccaggtcggcgacctgtac
agccagaacagcagcgacctgaacgactatcagcggctgctggacagtgatcaacccgca
acactgcgcgggctgatctgcagcgaggacgaccggatcagacgcgccgtcatccagcag
ttgatctgccacttcaccctgaatttcagtgaactggaaaaagcgttcgccataagtttc
cgggactacttcgccgatgcgtggccgcagttgctgtgcatggcagacgacgggctgatt
acgctgagcgatagtgcaattgaagtcaggccagcgggccggttgctggtgcgctcggtg
tgcatggtatttgacgcgtacctgacccggcagaacaggcagcagttctcccgggcgata
taa

DBGET integrated database retrieval system