KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_2964Help
Entry
PSPTO_2964        CDS       T00118                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00450  Selenocompound metabolism
pst00970  Aminoacyl-tRNA biosynthesis
pst01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pst00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PSPTO_2964
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PSPTO_2964
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pst01007]
    PSPTO_2964
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pst03016]
    PSPTO_2964
Enzymes [BR:pst01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     PSPTO_2964
Amino acid related enzymes [BR:pst01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   PSPTO_2964
Transfer RNA biogenesis [BR:pst03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PSPTO_2964
 Prokaryotic type
   Other AARSs
    PSPTO_2964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1e tRNA-synt_1 tRNA-synt_1f PolC_DP2
Motif
Other DBs
NCBI-GeneID: 1184618
NCBI-ProteinID: NP_792761
UniProt: Q881D0
Position
complement(3333375..3334859)
Genome map
AA seq 494 aa AA seqDB search
MTITPPTPNGDLHIGHIAGPFLAADVFTRVQRQRGHDCVLVSYSDDYQSYMLRKGLEQGV
DPVVLAHRNSDRIEASLAAINIKPDNWMRPHNNPWFAEAVGEVFTALRDAGAIEFRDSSE
PYCPDCAVWGYEAFARGQCNYCGAESDASQCENCAQAPDAELMSGLHCKLCQQPSQWKTA
HRAFLKLADFKPQLGNRLLGQAWRKPLDSWLRDTLEHLHDWGVTRPGDGGLDLQADGACR
VHTWFMGLAGYMAAFREYADSIGRPELFGQYWQSGQGTLVHFLGFDCVFSHAIVYPAQLS
VLQGIKVRQRFVPNQFLKLDGLNLSTSRNHAIWVGDLARQACADSARLYLASIAPEDSEG
DFRMTHFFEWREELFNGFFPALLEAAKSRDDSGWSGVCGTDAGLLEALRLQWTRAAEPAQ
FSMKGLARVLLDAIAITRARLAEGRPVSHLAAFIAVAGKALIPDRSAQLITAFGLPEARV
NATLMNGSAAEYSI
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatcacgccgccgacccccaacggtgacctgcacatcggccatattgccggcccg
tttctggccgccgatgtgttcacccgtgtgcagcgccaacgcggtcacgactgcgtgctg
gtctcctattccgacgattaccagtcctacatgttgcgcaaggggctggagcagggcgtc
gatccggtggtgctggcccatcgcaactcggatcgcatcgaagcctcgctggcggcgatc
aatatcaagcccgacaactggatgcgtccgcacaataacccttggttcgccgaagcggtg
ggcgaagtgttcacggcgttgcgcgacgccggggcgatcgagtttcgcgactccagcgag
ccttattgccctgattgtgctgtctggggttacgaggcgtttgcccgtggccagtgcaac
tattgtggcgcggagtcggatgccagccagtgcgagaactgcgcccaggcccccgacgca
gaactaatgagcggcttgcactgcaagctctgccagcagccgtcgcagtggaaaaccgcg
catcgggcgtttctcaaactggctgatttcaagccgcaactgggtaatcgcctgctcggt
caggcgtggcgcaagcccctcgacagctggttgcgcgacacgctggagcacctgcacgac
tggggcgtgacgcgcccgggtgacggcgggctcgacttgcaagccgacggcgcgtgtcgg
gtgcatacctggttcatggggctggccggctacatggctgcgtttcgtgagtacgccgac
agcatcggccgccccgagctgtttggtcagtactggcagtcggggcagggcacgctggtg
cactttctcggttttgactgcgtgttcagccacgccatcgtctacccggcgcaattgtcg
gtgctgcagggcatcaaggtccgccagcgcttcgtgcccaatcagttcctcaaacttgat
ggcctgaatctgtcgaccagccgcaaccatgcgatttgggttggcgatctggcccgtcag
gcctgcgccgacagcgcgcgcctgtacctggcgagcattgcgcctgaggacagcgagggc
gattttcgaatgacgcatttctttgaatggcgggaagagctgttcaatggctttttcccc
gccttgctggaggccgcaaaaagtcgcgacgacagtggatggagcggtgtctgcgggacg
gatgccggtttgctggaagccttgcgcctgcaatggacccgcgccgcagagcctgcgcag
ttctccatgaaaggcttggctcgtgttctgctggatgcgattgccatcacccgcgctcgt
ttggccgagggccgccctgtcagtcacctggcggcgttcatcgcggtggccggcaaagcg
ctgattccggataggtcagcgcagctcatcaccgcattcgggctgcccgaagcccgggtc
aacgccacgctcatgaacggctcggccgctgaatactccatctga

DBGET integrated database retrieval system