KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_3164Help
Entry
PSPTO_3164        CDS       T00118                                 

Gene name
phbA-2
Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00071  Fatty acid degradation
pst00072  Synthesis and degradation of ketone bodies
pst00280  Valine, leucine and isoleucine degradation
pst00310  Lysine degradation
pst00362  Benzoate degradation
pst00380  Tryptophan metabolism
pst00620  Pyruvate metabolism
pst00630  Glyoxylate and dicarboxylate metabolism
pst00640  Propanoate metabolism
pst00650  Butanoate metabolism
pst00900  Terpenoid backbone biosynthesis
pst01100  Metabolic pathways
pst01110  Biosynthesis of secondary metabolites
pst01120  Microbial metabolism in diverse environments
pst01130  Biosynthesis of antibiotics
pst01200  Carbon metabolism
pst01212  Fatty acid metabolism
pst02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSPTO_3164 (phbA-2)
   00630 Glyoxylate and dicarboxylate metabolism
    PSPTO_3164 (phbA-2)
   00640 Propanoate metabolism
    PSPTO_3164 (phbA-2)
   00650 Butanoate metabolism
    PSPTO_3164 (phbA-2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PSPTO_3164 (phbA-2)
   00072 Synthesis and degradation of ketone bodies
    PSPTO_3164 (phbA-2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSPTO_3164 (phbA-2)
   00310 Lysine degradation
    PSPTO_3164 (phbA-2)
   00380 Tryptophan metabolism
    PSPTO_3164 (phbA-2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSPTO_3164 (phbA-2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSPTO_3164 (phbA-2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PSPTO_3164 (phbA-2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pst04147]
    PSPTO_3164 (phbA-2)
Enzymes [BR:pst01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PSPTO_3164 (phbA-2)
Exosome [BR:pst04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSPTO_3164 (phbA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 1184821
NCBI-ProteinID: NP_792954
UniProt: Q880J3
Position
complement(3556756..3557964)
Genome map
AA seq 402 aa AA seqDB search
MSIERTIPHHDPVVIVSAARTPMGGFQGDLQSLGATRLGSIAIRAAVERAAIAPGDVEHV
LFGCVLPAGCGQAPARQAALGAGLSTGTLCSTVNKMCGSGMQTAIMAHDLLMADAATVVV
AGGMESMSNAPYLLDRARSGYRMGHGKVLDHMFLDGLEDAYEPGRLMGTFAEDCAQRHAL
SREAQDAFALASLARAQQAITDGHFDAEIVPVQVTVGKESRHITHDEQPPKARPDKIPTL
KPAFRDGGTVTAANSSSISDGAAALLLMRQSQAQRRGLQPLAIFHAHAGFADEPGLFPTA
PIGAIQRLLGKTGWALDDVDLFEINEAFAVVPMVAMSELGIPHEKVNVNGGACALGHPIG
ASGARIIVTLLAALRRRQLKRGLAAICIGGGEATAVAIELVY
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcgagaggacaatccctcatcacgaccctgtggtcattgtcagcgcagcgcgc
acgcccatgggtggttttcagggcgacttgcagagccttggcgcgacccggctggggtcg
attgccatccgtgccgccgtcgaacgcgccgccattgccccgggtgacgtagagcacgtg
ctgtttggttgcgtgctgccggcgggttgtggccaggcgcctgcccggcaagcggccttg
ggtgcagggttgagcaccggcacgttgtgcagcacggtcaacaagatgtgcggctcgggg
atgcagaccgccattatggcccatgatttgctgatggccgacgctgccaccgtggtggtg
gccgggggcatggagagcatgtccaatgcgccttatctgctcgaccgcgcgcgcagcggt
tatcgcatggggcacggcaaggtgctggaccacatgtttctcgacggccttgaagatgcc
tatgagccaggccgactgatgggcaccttcgccgaagactgtgctcagcgccatgctttg
agccgcgaagcgcaggacgcgttcgctctggcatcactggcccgcgcgcagcaggccatc
accgacgggcacttcgatgccgagattgttccggtgcaggtcacggtgggcaaagaatcc
aggcacatcacccatgacgagcagccgcccaaggcgcgtccagacaagatcccgacactc
aaaccggcgtttcgcgacggcggtacggtcacggcagccaactccagttccatctccgat
ggcgcagcggcgctattgttgatgcgtcagtcacaagcgcagcgccgaggcttgcagccg
ctggccatattccacgcccatgcaggcttcgccgacgaaccggggctgtttccgacagcg
cccatcggggccattcagcgcctgctgggcaagacaggctgggcactggatgacgtcgat
ctgttcgagatcaacgaggcattcgcagttgtgccgatggtggccatgagcgagctgggt
atcccgcacgagaaggtcaacgtcaatggcggcgcctgtgcactgggtcacccgataggg
gcttcgggcgcgcggatcattgtcacgttgctggcagccttgcggcgcaggcagctcaag
cgtgggttggcagcaatctgcattggtggtggtgaagcgaccgctgttgctattgaattg
gtttattaa

DBGET integrated database retrieval system