KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_4144Help
Entry
PSPTO_4144        CDS       T00118                                 

Definition
(RefSeq) deoxycytidine triphosphate deaminase
  KO
K01494  dCTP deaminase [EC:3.5.4.13]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00240  Pyrimidine metabolism
pst01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pst00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    PSPTO_4144
Enzymes [BR:pst01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.13  dCTP deaminase
     PSPTO_4144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dUTPase Flagellar_put
Motif
Other DBs
NCBI-GeneID: 1185824
NCBI-ProteinID: NP_793905
UniProt: Q87XN2
Position
complement(4671393..4671959)
Genome map
AA seq 188 aa AA seqDB search
MSIKSDKWIRRMAQEHGMIEPFVERQVRGEGANRVISFGVSSYGYDVRCADEFKVFTNIN
SATVDPKNFDEKSFVDIKSDVCIIPPNSFALARTVEYFRIPRNVLTICLGKSTYARCGII
VNVTPLEPEWEGHVTLEFSNTTTLPAKIYANEGVAQMLFLESDEECEVSYKDRGGKYQGQ
RGVTLPRT
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcaaatcggacaagtggattcgccgcatggcgcaggaacacggcatgatcgag
cccttcgtcgagcgccaggtgcgtggcgaaggcgccaaccgggtgatctcgttcggggtg
tccagctacggttacgatgtgcgttgcgccgacgaattcaaggtgttcaccaacatcaat
tcggctaccgtcgacccgaaaaatttcgatgaaaaaagttttgtcgatatcaaaagcgac
gtctgcatcatcccgcccaattcgttcgcgctggcccgcaccgtcgaatatttccgtatt
ccgcgcaacgttctgaccatctgtctgggcaaaagcacctacgcgcgctgcggcatcatc
gtcaacgtcacgccgctcgagccggaatgggaagggcatgtgacactggaattttccaac
accaccacgctgccagccaagatctacgccaatgaaggcgtggcgcagatgctgtttctg
gagtccgacgaggagtgtgaagtttcctacaaggaccgtggcggcaagtaccagggccag
cgtggcgtcaccctgccgcgcacctga

DBGET integrated database retrieval system