KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_4464Help
Entry
PSPTO_4464        CDS       T00118                                 

Definition
(RefSeq) hypothetical protein
  KO
K09889  ribosome-associated protein
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Brite
Ribosome biogenesis [BR:pst03009]
 Prokaryotic Type
  Other maturation factors
   PSPTO_4464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF615 STIL_N Uso1_p115_C
Motif
Other DBs
NCBI-GeneID: 1186145
NCBI-ProteinID: NP_794218
UniProt: Q87WS9
Structure
PDB: 

Position
5025530..5026051
Genome map
AA seq 173 aa AA seqDB search
MVDSYDDSLDGEKSKTQVKRELHALVDLGERLTTLKADVLAKLPLTDALRKALAEAPKHT
ANIARKRHILFIGKLMRDQDQEAILVLLDQLDASTRQYNERFHNLERWRDRLIAGDDADL
EKFVIEYPDADRQQLRSLIRQAQHEVARNKPPATSRKIFKYIRELDELQRGLR
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggttgattcttacgacgactccctcgacggggagaaaagcaaaacccaggtcaaacga
gagctgcatgctctggtcgacctcggcgagcgactgacaacactcaaagccgatgtgctg
gccaagctgccgctgaccgatgctttgcgcaaagccctggccgaagcgcccaagcacacc
gccaacatcgcccgaaaacggcatattctgttcattggcaagctgatgcgcgatcaggac
caggaagccattctggtgttgctggaccaactcgatgcctccactcgccagtacaatgaa
cgttttcacaatctggagcgctggcgtgatcgcctgatcgcgggtgatgacgccgacctc
gagaaattcgttatcgaataccccgacgccgaccgtcagcagctgcgttcgctgattcgt
caggcgcaacacgaagttgcacgcaacaaaccgccggccaccagccgcaaaatcttcaaa
tacatccgtgagctggacgaacttcaacgcggtctgcgttga

DBGET integrated database retrieval system