KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_4508
Entry
PSPTO_4508        CDS       T00118                                 

Gene name
fur
Definition
(RefSeq) ferric uptake regulation protein
  KO
K03711  Fur family transcriptional regulator, ferric uptake regulator
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Brite
KEGG Orthology (KO) [BR:pst00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pst03000]
    PSPTO_4508 (fur)
Transcription factors [BR:pst03000]
 Prokaryotic type
  Helix-turn-helix
   Fur family
    PSPTO_4508 (fur)
SSDB
Motif
Pfam: FUR PadR HTH_20 CDI HTH_12
Other DBs
NCBI-GeneID: 1186191
NCBI-ProteinID: NP_794261
UniProt: Q87WN7
Position
complement(5080338..5080745)
AA seq 135 aa
MVENSELRKAGLKVTLPRVKILQMLDSAEQRHMSAEDVYKALMEASEDVGLATVYRVLTQ
FEAAGLVVRHNFDGGHAVFELADGGHHDHMVNVESGEVIEFFDEEIEKLQKAIVERHGFD
LVDHNLVLYVRNKKA
NT seq 408 nt   +upstreamnt  +downstreamnt
atggttgaaaatagcgaactacgaaaagcaggactaaaggtaaccctaccgagggttaaa
atactccaaatgctcgattctgccgagcagcgccacatgagtgccgaggatgtttacaag
gcactgatggaggctagcgaggacgtcggcctggccacggtttaccgtgtcctgacccag
tttgaagctgcgggattggtggttcgccacaatttcgacggtggtcatgctgtgtttgag
ctggctgatggcggccatcacgaccacatggtcaacgtggagtcaggcgaggtgattgaa
ttcttcgatgaagaaatcgagaagcttcaaaaagccatcgtcgaaagacacggctttgac
ctggtggaccacaatctggtgctttacgtacgcaacaaaaaggcgtga

DBGET integrated database retrieval system